SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014571 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014571
Domain Number 1 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.85e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.16e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 3 Region: 512-569
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 1-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-21
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.31e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 205-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 8 Region: 149-205
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000146
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 9 Region: 558-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000004
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 476-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000504
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 597-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000373
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014571   Gene: ENSMMUG00000012753   Transcript: ENSMMUT00000015558
Sequence length 642
Comment pep:known_by_projection chromosome:MMUL_1:19:22740298:22752633:1 gene:ENSMMUG00000012753 transcript:ENSMMUT00000015558 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDVAVEFSLEEWQCLDTIQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEKEPWTRK
RHRMVAKPAPVTCSHFAQDFSPEQNIKDSFQKVTLRRHGKCEHENLQLRKCGKSVDECKV
QKGGYNGLNQCLPATQSKLFHCDEYMKIFHKFSNLNGHKIRHTGKKPFKCKEFGKSFCMF
SNLTQRKITCTRVNFYKCEDCGKAFNGSLIFTKHKRIHNGEKPYKCEECGKAFNLSSHIT
THKIIHTGENPYKHEECDKAFNQSSTLTTHKIIHTREKLNEYKEYGKAFNQPSHLTRHKI
IHTGEKAYKCEECGKAFNQSSHLTRHKIIHTGEKPYKCEECGKAFRQSSHLTTHKMIHTG
EKPYKCEECGKAFNKSSHLTRHKSIHAGEKPYQCEKCGKTSNQSSNLTEHKNIHTEEKPY
KCEECGKAFKQLSNLTTHKRIHTGEKPYKCEECGKAFNQSSILTTHKRIHTGEKSYKCEE
CGKAFYRSSKLTEHKKIHTREKRYTCEECGKAFNHSSHLTTHKVIHTGEKFYQCEECGKA
FNQSSHLTRHKRIHTGEKPYQCEKCGKAFNQSSNLTVHKKIHTGEKLYKPKRCNSGFENT
SNFSKHKRNYTGEKLHKCEECGKTCNQCSHLIAQETICTRKK
Download sequence
Identical sequences ENSMMUP00000031699 ENSMMUP00000014571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]