SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014598 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014598
Domain Number 1 Region: 1066-1160
Classification Level Classification E-value
Superfamily Immunoglobulin 9.76e-24
Family I set domains 0.0033
Further Details:      
 
Domain Number 2 Region: 778-871
Classification Level Classification E-value
Superfamily Immunoglobulin 2.89e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 3 Region: 874-968
Classification Level Classification E-value
Superfamily Immunoglobulin 4.25e-21
Family I set domains 0.0084
Further Details:      
 
Domain Number 4 Region: 129-223
Classification Level Classification E-value
Superfamily Immunoglobulin 8.71e-21
Family I set domains 0.015
Further Details:      
 
Domain Number 5 Region: 320-416
Classification Level Classification E-value
Superfamily Immunoglobulin 1.4e-19
Family I set domains 0.03
Further Details:      
 
Domain Number 6 Region: 970-1064
Classification Level Classification E-value
Superfamily Immunoglobulin 1.94e-18
Family I set domains 0.0024
Further Details:      
 
Domain Number 7 Region: 420-507
Classification Level Classification E-value
Superfamily Immunoglobulin 2.71e-18
Family I set domains 0.0097
Further Details:      
 
Domain Number 8 Region: 1162-1249
Classification Level Classification E-value
Superfamily Immunoglobulin 5.51e-18
Family I set domains 0.0061
Further Details:      
 
Domain Number 9 Region: 224-318
Classification Level Classification E-value
Superfamily Immunoglobulin 1.14e-16
Family I set domains 0.01
Further Details:      
 
Domain Number 10 Region: 685-775
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000174
Family I set domains 0.007
Further Details:      
 
Domain Number 11 Region: 36-125
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000228
Family I set domains 0.0093
Further Details:      
 
Domain Number 12 Region: 591-682
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000484
Family I set domains 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014598   Gene: ENSMMUG00000011152   Transcript: ENSMMUT00000015587
Sequence length 1338
Comment pep:known_by_projection chromosome:MMUL_1:X:129493218:129508983:-1 gene:ENSMMUG00000011152 transcript:ENSMMUT00000015587 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRRGEGATMLKTFTVLLFCIRMSLGTTSIVMDPQPELWIESNYPQAPWENITLWCRS
PSRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKEPGWSKPSKV
LELEAPGQLPKPIFWIQAETPPLPGCNVNILCHGWLQDLVFMLFKEGYAKPVDYQVPTGT
MAIFSIDNLTPEDEGVYICRTHIQMLPTLWSEPSNPLKLVVAGLYPKPTLTAHPGPIMAP
GESLNLRCQGPIYGMTFALMRVEDLEKSFYHKKTIKNEAYFFFRSLKIQDTGHYLCFYYD
ISYRGSLLSDVLKIWVTDTFPKTWLLAWPSPVVQMGQNVSLWCRGPVDGVGLALYKKGED
KPVQFLDATSIDDNTSFFLNNVTYSDTGIYSCQYLLTWKTSIRMPSHNTVELMVVGKYKP
PKPSLSAWPSTVFKLGKAITLRCRVSHPVLEFSLEWEEREAFQKFSVDGDFIISNVDGKG
TGTYSCSYRVETHPNIWSHRSEPLKLMGPAGYLTWNYVLNEAVRLSLIVQLVALLLVVLW
IRWKCRRLRIREAWLLGTAQGVTMLFIVTALLSCGLCNGVLIEETEIVMPTPKPELWAET
NFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHTGSY
HCHSWEEMAVSEPSEALELLGTDILPKPVISASLPIRGQELQLRCKGWLAGMGFALYKEG
QQEPVQQLGAVGREAVFTIQRMEDKDEGNYSCRTHTEQRPFKWSEPSEPLELVIKEMYPK
PFFKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFLIIS
VGIGDGGNYSCRYYDFSIWSEPSDPVELVVTEFYPKPTLLAQPGPVVFPGKSVTLRCQGT
FQGMRFALLQEGAQVPLQFQSVSGNSADFLLHTVGAEDSGNYSCIYYETTMSNRGSYLSI
PLMIWVTDTFPKPWLFAEPSSVVPMGQNVTLWCRGPVHGVGYILHKEEEATSMQLWGSTS
NDGAFPITNISGASMGRYSCCYHPDWTSSIKIQPSNTLELIVTGLLPKPSLLAQPGPMVS
PGENMTLQCQGELPDSTFVLLKEGTQEPLEQQRPSGYRADFWMPAVRGEDSGIYSCVYYL
DSAPFAASNHSDSLEIWVTDKPPKPSLSAWPGTMFKLGKDIILQCRGPLPGVEFVLEHDG
EEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDSLELVGAAGPVAQECT
VGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRGSETDGRDQTIALEECNQEGEPGTPA
NSPSSTSRRISVELPVPI
Download sequence
Identical sequences ENSMMUP00000014598

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]