SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014728 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014728
Domain Number 1 Region: 639-696
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-20
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 2 Region: 527-584
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 3 Region: 583-640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-19
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 332-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-18
Family Classic zinc finger, C2H2 0.009
Further Details:      
 
Domain Number 5 Region: 388-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.57e-18
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 
Domain Number 6 Region: 681-733
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.37e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 7 Region: 275-332
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 8 Region: 472-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.6e-16
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 237-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000298
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 2-46
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000000000222
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 11 Region: 434-465
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000609
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 12 Region: 174-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000277
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014728   Gene: ENSMMUG00000011237   Transcript: ENSMMUT00000015722
Sequence length 745
Comment pep:known_by_projection chromosome:MMUL_1:3:186424498:186436132:-1 gene:ENSMMUG00000011237 transcript:ENSMMUT00000015722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTVTFDDVALYFSEQEWEILEKWQKQMYKQEMKTNYQTLDSLGKMSKESSVGWLKMILGP
VYIHNNCLNPGGGALKPNYRVDISLMRVILLSAPDHEGTLRTKEEDCRLNGPQKQDLGAA
LPGKERKILSARRDTFQSPSLQETEIPNKKVSITASDPDKKDLRHKPRETPGRLEIPTGP
RCYSCYVCRKVFQVRRDLLKHKRSHSKSQLRRYPKYRNTSRGKSELRRTQRLLCQKKRFQ
CSECEKSYFLKGSLVTHQVVHTGQRPYPCPECDKTFRYRANLKKHLCLHRGERPFCCGEC
GRAFVQQCELTEHLRLHSGEKPFQCPQCDRCFRLKRGMKVHLSQHSGKRPFHCPECGRSF
SRKAALKTHQRTHSEEKPFSCDECGRKFIYKIKLDEHIRVHTGEKPFSCPECNKSFRLKR
SLKAHGLQHSGKRPFQCPECSRGFFWRNAMRAHQRLHSEQKPFPCAECGKRFTRPSKLAC
HTRVHDRQKEFPCGECKKTFSQQSRLTQHLKVHNTEKPFSCAECGRSFRRRAHLTEHTRL
HSGEEPFQCPECDKSFSWKASMKFHQRMHRDEKPFACSECGKTYTHQSQLTEHLRLHSGE
KPYQCPECQKTFRLKGNLKSHLLQHSGQKPFSCVMCGKSFTQQYRLTEHIRVHSGEKPFQ
CPECDKSYCIRGSLKVHLYTHSGERPFQCPECGKGFLQKRSLKAHLCLHSGERPFSCDEC
GRSFTYVGALKTHIAVHAKEKPSSL
Download sequence
Identical sequences 9544.ENSMMUP00000014728 ENSMMUP00000014728 ENSMMUP00000014728

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]