SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014771 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014771
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 2 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.84e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 670-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 503-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-22
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 8 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.71e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.94e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 10 Region: 1-56
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.48e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 11 Region: 142-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.79e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 12 Region: 716-768
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-19
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 13 Region: 241-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000272
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 14 Region: 117-147
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000089
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014771   Gene: ENSMMUG00000011275   Transcript: ENSMMUT00000015767
Sequence length 778
Comment pep:known_by_projection chromosome:MMUL_1:19:21613154:21628588:1 gene:ENSMMUG00000011275 transcript:ENSMMUT00000015767 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LTFQDVTIEFSLEEWQCLDTAQQTLYRDVMLENYRNLVFLGIAVSKLDLIACLKQGKESW
NMKRHEMKNFKGFMYYYFNISFLLLHQNLICKVYLSLIFQCNKDMKVVHKYSNSNRNKVR
HTKKKTFKCIKCSKSFLMLSHLIQHKKHEKIHTGEKPYKCEECGKAFNQSSTLKKHNIIH
TGKKPYKCDECGKAFNSSSTLMKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEK
PYKCEECGKAFNHFSAPRRHKIIHTGKKPYKCEECGKAFSQSSTLRKHVIIHTGEKPYKC
EECGKAFKWSSKLTLHKVIHTGEKPCKCEECGKAFKHFSALRKHKVIHTGKKPYKCEECG
KAFSQSSTLRKHEIIHSGEKPYKCEECGKAFKWLSKLTLHKVIHTGEKPCKCEECGKAFK
HFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGKKPYKCEQCGKAFKQSSH
LTRHKVIHTGEKPYKCEECGKDFNNPSTLKKHKLIHTREKLYKCEECGKAFNNFSALLKH
KIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEECGKAFKHFSALRKHKIIH
TGKKPYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFNNFSTLMKHKIIHTGEK
PYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFNNFSTLRKHKRIHTVEKPYKC
EECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQCSYLTRHKTIHIEEKPYKGIL
Download sequence
Identical sequences ENSMMUP00000014771 ENSMMUP00000014775 9544.ENSMMUP00000014771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]