SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014775 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014775
Domain Number 1 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 594-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.52e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 6 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.68e-23
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 146-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.79e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 8 Region: 2-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-20
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 9 Region: 108-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-20
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 10 Region: 636-686
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-18
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 557-589
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000504
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 12 Region: 389-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000074
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 13 Region: 473-505
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000902
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 14 Region: 305-337
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000934
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000014775
Domain Number - Region: 88-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0271
Family Classic zinc finger, C2H2 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014775   Gene: ENSMMUG00000011275   Transcript: ENSMMUT00000015771
Sequence length 687
Comment pep:known_by_projection chromosome:MMUL_1:19:21613139:21629304:1 gene:ENSMMUG00000011275 transcript:ENSMMUT00000015771 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FFQGPLTFQDVTIEFSLEEWQCLDTAQQTLYRDVMLENYRNLVFLGDLRRCAPKEVVSEK
KSFCSYLEKWTLYQSMKDCFQEVILRTYTRSLRKHEKIHTGEKPYKKKPYKCDECGKAFN
SSSTLMKHKIIHTGKKPYKCEECGKAFRQSSHLTRHKAIHTGEKPYKCEECGKAFNHFSA
PRRHKIIHTGKKPYKCEECGKAFSQSSTLRKHVIIHTGEKPYKCEECGKAFKWSSKLTLH
KVIHTGKKPYKCEECGKAFSQSSTLRKHEIIHSGEKPYKCEECGKAFKWLSKLTLHKVIH
TGEKPCKCEECGKAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGKK
PYKCEQCGKAFKQSSHLTRHKVIHTGEKPYKCEECGKDFNNPSTLKKHKLIHTREKLYKC
EECGKAFNNFSALLKHKIIHTGEKPYKCEECGKAFKWSSKLTEHKVIHTGEKPCKCEECG
KAFKHFSALRKHKIIHTGKKPYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFN
NFSTLMKHKIIHTGEKPYKCEECGKAFNNSSTLMKHKIIHTGEKPYKCEECGKAFNNFST
LRKHKRIHTVEKPYKCEECGKAFNQSSHLTRHKTIHTGEKPYKCEECGKAFIQCSYLTRH
KTIHIEEKPYKDKECGKTFNQSSNLTR
Download sequence
Identical sequences ENSMMUP00000014775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]