SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014781 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014781
Domain Number 1 Region: 185-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-26
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 2 Region: 409-466
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.16e-26
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 353-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 493-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 5 Region: 549-606
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 269-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.72e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 7 Region: 1-62
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-21
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 8 Region: 593-653
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 147-199
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000116
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 10 Region: 456-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000512
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 11 Region: 232-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000436
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 12 Region: 316-348
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000136
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014781   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000015777
Sequence length 653
Comment pep:known_by_projection chromosome:MMUL_1:19:22395014:22408742:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000015777 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLLTFRDVAIEFSLEEWQRLDAAQQNLYRNVMLENYRNLAFLGKTGIAVSKPDLITCLE
QGKEPWNMKRHEMVDKAPAAICPHFAQDFWPEQGMEDSFQKVLLRKYEKCGHENLQLRKS
CKSVDECKVHREGYSKLNQCFTTTRSKVFQCGKYLKVFHKFLNSNRHMIIHSGQKPYKCE
ECGKAFLWSSTLTRHKRIHTGEKPYKCEECGKAFRQSSTLTKHKRIHTGEKPYKCEECGK
AFRQSLTLTKHKRIHTGEKPCKCEECGKAFSHSSTLAKHKRIHTGEKPYKCKECGKAFSN
SSTLTNHKITHTEEKPYKCKECGKAFKRLSTLTKHKIIHAGEKLYKCEECGKAFNRSSNL
TAHKIIHTGEKPYKCEECGKAFIWSSSLTKHKRIHTREKPYKCEECGKAFSQPSHLTTHK
RMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGKAFRKSSTLTEHKIIHT
GEKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFNRSSKLTTHKIIHTGEKP
YKCEECGKAFISSSTLTGHKRIHTREKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCE
ECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHKKIHTREKPY
Download sequence
Identical sequences ENSMMUP00000014781

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]