SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014978 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014978
Domain Number 1 Region: 22-140
Classification Level Classification E-value
Superfamily Thioredoxin-like 9.71e-32
Family PDI-like 0.028
Further Details:      
 
Domain Number 2 Region: 240-368
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000255
Family PDI-like 0.022
Further Details:      
 
Domain Number 3 Region: 142-243
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000104
Family Calsequestrin 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014978   Gene: ENSMMUG00000011415   Transcript: ENSMMUT00000015983
Sequence length 406
Comment pep:known_by_projection chromosome:MMUL_1:15:36122150:36238716:1 gene:ENSMMUG00000011415 transcript:ENSMMUT00000015983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRF
SQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMK
REYRGQRSVKALADYIRQQKSNPIQEIRDLAEITTLDRQRNLLLTSQQQKDSDNYRVFER
VANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDK
CVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHAD
CDKFRHPLLHIQKTPADCPVIAIDSFRHMYYLDTMLTIVIPGKLKQFVFDLHSGKLHREF
HHGPDPTDIAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Download sequence
Identical sequences ENSMMUP00000014978 9544.ENSMMUP00000014978 ENSMMUP00000014978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]