SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015160 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015160
Domain Number 1 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-24
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 397-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.32e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 547-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.51e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 6 Region: 332-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.92e-20
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 248-300
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.7e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 8 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.09e-19
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 9 Region: 632-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.66e-19
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000015160
Domain Number - Region: 197-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000523
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015160   Gene: ENSMMUG00000011550   Transcript: ENSMMUT00000016177
Sequence length 686
Comment pep:known chromosome:MMUL_1:8:147477857:147492774:1 gene:ENSMMUG00000011550 transcript:ENSMMUT00000016177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVVTFGDVAVHFSREEWQCLDPGQRALYREVMLENHSSVAGLAGFLVFKPELISRLEQG
EEPWVLDLQGAEGTEAPRTSKTDSTIRTENEQSCEDMDILKSESYGTVIRISPQDFPQNP
GFGDVSDSEVWLDSHLGSRGLRMTGSTFQNNCLNEETVVPKTFIKDAAQGCKELGSSILD
CQPPESQRESAEGTSQRCEGCGKGFRATSDIALHWEINTQKISRCQECQKKLSDCLQGKH
PNNCHGEKPYECAECGKVFRLCSQLNQHQRIHTGEKPFKCTECGKAFRLSSKLIQHQRIH
TGEKPYRCEECGKAFGQSSSLIHHQRIHTGERPYGCCECGKAFSQQSQLVRHQRTHTGER
PYPCKECGKAFSQSSTLAQHQRMHTGEKAQILRASDSPSLVAHQRIHAVEKPFKCDECGK
AFRWISRLSQHQLIHTGEKPYKCNKCTKAFGCSSRLIRHQRTHTGEKPFKCDECGKGFVQ
GSHLIQHQRIHTGEKPYVCNDCGKAFSQSSSLIYHQRIHKGEKPYECLQCGKAFSMSTQL
TIHQRVHTGERPYKCNECGKAFSQNSTLFQHQIIHAGVKPYECSECGKAFSRSSYLIEHQ
RIHTRAQWFYEYGNALEGSTFVSRKKVNTIKKLHQCEDCEKIFRWRSHLIIHQRIHTGEK
PYKCNDCGKAFNRSSRLTQHQKIHTG
Download sequence
Identical sequences F7BTL8
9544.ENSMMUP00000015160 NP_001253500.1.72884 XP_005564470.1.63531 XP_011710254.1.29376 XP_011710255.1.29376 XP_015001722.1.72884 XP_015001724.1.72884 XP_015310895.1.63531 ENSMMUP00000015159 ENSMMUP00000015160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]