SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015247 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015247
Domain Number 1 Region: 220-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.55e-20
Family Classic zinc finger, C2H2 0.0033
Further Details:      
 
Domain Number 2 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.25e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 3 Region: 1-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.02e-17
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 4 Region: 343-398
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-16
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 5 Region: 184-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000194
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 141-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000108
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 401-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000248
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015247   Gene: ENSMMUG00000011617   Transcript: ENSMMUT00000016274
Sequence length 450
Comment pep:novel scaffold:MMUL_1:1099548049765:1052392:1066249:1 gene:ENSMMUG00000011617 transcript:ENSMMUT00000016274 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGVLTFRAVAIEFCPEEWECLHSAQQHLYRNVMLENYRNLLFLKTGFAVSKSKLITCLEQ
GKESWNVKRQETAAKHLGWCSIVVAEILPKQDIKYSSKNITLIKYESCDLDNLYLKKYWQ
GVNNCKGQNCLHQCLSTTHSKTCQCNKCGKAFDWCSILTEDRKICSREKPYKCDECGKAC
RMPYKHKRTHTRGESYKCEECGRAFTCSSTLTKHKGIHAGEKSYRYEECGRVFTRSSALT
KKRIHAGEKPYKCEECGRVFTHSSTLIKHKRIHTGEKPYKCEEFGRAFKNFSDLTKRKII
HTVERPYKCEEYGKVCKWFSELTKHKRIHTREKPYKCEDCGKAYTWSSGLTNHKRTRAGD
KPYTCEEYGTAFSCFSAFLKHRIVHAAKRPYKCGECGKAKCLSALTKHNRIHYEEKFKCS
KCEKALNMSSDFVLNQRFHTEKIQCKCNHC
Download sequence
Identical sequences ENSMMUP00000015247

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]