SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015505 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015505
Domain Number 1 Region: 174-322
Classification Level Classification E-value
Superfamily TPR-like 3.8e-19
Family Tetratricopeptide repeat (TPR) 0.0024
Further Details:      
 
Domain Number 2 Region: 7-94,132-158
Classification Level Classification E-value
Superfamily FKBP-like 2.16e-18
Family FKBP immunophilin/proline isomerase 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015505   Gene: ENSMMUG00000011817   Transcript: ENSMMUT00000016554
Sequence length 330
Comment pep:known chromosome:MMUL_1:14:6965118:6973762:-1 gene:ENSMMUG00000011817 transcript:ENSMMUT00000016554 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADIIARLREDGIQKRVIQEGRGELPDFQDGTKATFHYRTLHSDNEGTVLDDSRVRGKPM
ELIIGKKFKLPVWETIVCTMREGEIAQFLCDIKHVVLYPLVAKSLRNIAAGKDPLEGQRH
CCGVAQMHEHSSLGHADLDALQQNPQPLVFHMEMLKVESPGTYQQDPWAMTDEEKAKAVP
LIHQEGNRLYREGHVKEAAAKYYDAIACLKNLQMKEQPGSPEWIQLDQQITPLLLNYCQC
KLVAEEYYEVLDHCSSILNKYDDNVKAYFKRGKAHAAVWNAQEAQADFAKVLELDPALAP
VVSRELRALEARIRQKDEEDKARFRGIFSH
Download sequence
Identical sequences A0A096MVH5 A0A2K5LIP8 F7H7B6
ENSMMUP00000015505 9544.ENSMMUP00000015505 ENSPANP00000003854 ENSMMUP00000015505 NP_001181242.1.72884 XP_011896817.1.92194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]