SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015520 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015520
Domain Number 1 Region: 245-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.5e-25
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 357-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 3-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-22
Family KRAB domain (Kruppel-associated box) 0.0015
Further Details:      
 
Domain Number 4 Region: 302-358
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.31e-22
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 5 Region: 399-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 189-246
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.64e-18
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 151-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000122
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015520   Gene: ENSMMUG00000009888   Transcript: ENSMMUT00000016569
Sequence length 462
Comment pep:known chromosome:MMUL_1:19:58483251:58488488:1 gene:ENSMMUG00000009888 transcript:ENSMMUT00000016569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQLLFRDVAIEFSQEEWKCLNPGQKALYRDVMLENYRNLISLGICLPDLSVISILEQKRD
PWTLQSDVKVANNPNGREYIKGVKTEKSSKLGRNAGNKPLKNQHGLTLQLHLAEWQPLQA
VRNIYGCKHVEKSISDNSSVLPVQISFSNVKTHICNNYKNDFVFSTILPQEQKIHIRGKP
YGCKEHGKVFRASSSRINHQVIHIADVPYKQSDCGEIFSSNSNLAQHRGIHTGEKPYKCN
ECGKVFNQNSYLAQHQKIHTGEKPYNCNECGKGFSRIAFLVRHWKVHTGEKPYKCNECGK
VFIGNSRLARHRKIHTGEKPCKCNKCGKAFRQYSDLTAHFLIHTGEKPYECIECGKVFGH
KSSLTYHSRIHTGEKPCKCNECGKVFRQNSHLARHRKIHTGEKLYKCNECGKVFSQNSHL
TQHRNIHTGEKAYSCNECGKVFSRNSHLSRHSESILERNLTN
Download sequence
Identical sequences ENSMMUP00000015520

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]