SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015545 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015545
Domain Number 1 Region: 620-646,677-916
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 2.23e-61
Family Nuclear receptor ligand-binding domain 0.00000000146
Further Details:      
 
Domain Number 2 Region: 567-645
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.83e-23
Family Nuclear receptor 0.0000286
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015545   Gene: ENSMMUG00000011846   Transcript: ENSMMUT00000016595
Sequence length 936
Comment pep:known_by_projection chromosome:MMUL_1:14:99664530:99754593:-1 gene:ENSMMUG00000011846 transcript:ENSMMUT00000016595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTELKAKSPRAPHVAGGPPSPEVGSPLLCRPAAGPFQGSQTSDTLPEVSAIPISLDGLLF
PRPCQGQDPLDEKTQDQQSLSDVEGAYSRAEATRGTGGSSSRPPEKDSGLLDSVLDTLLA
PSGPGQSQPSPPACEVTSSWCLFGPELPEDPPAAPATPATQRVLSPLMSRSGGKAGDSSE
TAAAHKVLPRGLSPSRQLLLPASGSPHWSGAPVKPSPLPTAVEVEEEDGSESEDSAGPLL
KGKPRALGGAAAGGGAAAVPPGAAAGGVALVPKEDSRFSAPRVALVEQDAPMAPGRSPLA
TTTMDFTHVPILPLNHALLAARTRQLLEEESYDGGAGAASAFAPPRSSPSASSTPVAVGD
FPDCAYPPDADPKDDAYPLYGDFQPPALKIKEEEEGAEVSARSPRSYLVAGANPAAFPDF
PLGPPPPLPPRAPPSRPGEAAVTAAPAGASVSSASSLGSTLECILYKAEGAPPQQGPFAP
PPCKAPGAGGCLLPRDGLPSTSASAATAGAAPALYPALGLNGLPQLGYQAAVLKEGLQQV
YPPYLNYLRPDSEASQSPQYSFESLPQKICLICGDEASGCHYGVLTCGSCKVFFKRAMEG
QHNYLCAGRNDCIVDKIRRKNCPACRLRKCCQAGMVLGGRKFKKFNKVRVMRALDAVALP
QPVGIPNESQALSQRFTFSPGQDIQLIPPLINLLVSIEPDVIYAGHDNSKPDTSSSLLTS
LNQLGERQLLSVVKWSKLLPGFRNLHIDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLY
FAPDLILNEQRMKESSFYSLCLTMWQIPQEFVKLQVSQEEFLCMKVLLLLNTIPLEGLRS
QTQFEEMRSSYIRELIKAIGLRQKGVVSSSQRFYQLTKLLDNLHDLVKQLHLYCLNTFIQ
SRALSVEFPEMMSEVIAAQLPKILAGMVKPLLFHKK
Download sequence
Identical sequences ENSMMUP00000015545 ENSMMUP00000015544 9544.ENSMMUP00000015545 NP_001265385.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]