SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000015852 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000015852
Domain Number 1 Region: 310-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.78e-25
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 3-50
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-23
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 3 Region: 197-254
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.29e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 365-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-22
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 5 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.42e-22
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 6 Region: 145-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 421-476
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.55e-17
Family Classic zinc finger, C2H2 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000015852   Gene: ENSMMUG00000012085   Transcript: ENSMMUT00000016926
Sequence length 481
Comment pep:known_by_projection chromosome:MMUL_1:19:58895114:58902626:-1 gene:ENSMMUG00000012085 transcript:ENSMMUT00000016926 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VFSFQGLLTFRDVAIEFSQEEWKCLDPAQRTLYRDVMLENYRNLVSLDISSKCMMNTLSS
TGQGNTEVFHTGILQRQASYHIGVLCSQEIEKNIHDFVFQWREDETNDHEAPVTEIKKLT
GSTDRYDQRLGGNKPIKDQLGSSFHLHLRRHRRIHTGEKPYKCKVCDKTFKHDSHLAQHT
RIHRGDKHYTCNECGKVFDQKATLACHHRSHTGEKPYRCNECGKTFSQTSHLVYHHRLHT
GEKPYKCNECGKTFARNSVLVIHKAVHTAEKPYKCNECGKVFKQRATLAGHRRVHTGEKP
YRCEECDKLFSRKSHLERHRRIHTGEKPYKCKVCDKAFRSDSRLAEHQRVHTGERPYTCN
ECGKVFSTKAYLACHQKLHTGEKLYKCEECDKVYIRKSHLERHRRIHTGEKPHKCDECGK
AFNSPSHLIRHQRIHTGQKSYKCRQCGKVFSLRSLLAEHQKIPFGDNCFKCNEYSKPSSI
N
Download sequence
Identical sequences 9544.ENSMMUP00000015852 ENSMMUP00000015852 ENSMMUP00000015855

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]