SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016085 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016085
Domain Number 1 Region: 475-767
Classification Level Classification E-value
Superfamily L domain-like 3.4e-49
Family Ngr ectodomain-like 0.025
Further Details:      
 
Domain Number 2 Region: 43-82,119-353,387-429
Classification Level Classification E-value
Superfamily L domain-like 2.21e-36
Family Ngr ectodomain-like 0.049
Further Details:      
 
Domain Number 3 Region: 864-1017
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 2.49e-26
Family Toll/Interleukin receptor TIR domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016085   Gene: ENSMMUG00000012263   Transcript: ENSMMUT00000017175
Sequence length 1032
Comment pep:known chromosome:MMUL_1:2:84168249:84173318:1 gene:ENSMMUG00000012263 transcript:ENSMMUT00000017175 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGFCCSALHPLSLLVQAMVLATTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSAAA
PRGNVTSLSLSSNRIHHLHDSDFARLPSLRRLNLKWNCPPVGLSPMHFPCHMTIEPSTFL
AVPTLEELNLSYNSITTVPALPKSLISLSLSHTNILVLDSDSLASLHSLRFLFMDGNCYY
KNPCRQELEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYLLLSYNRIIKLAPEDL
ANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRQLNLSFNYHKRVSFAHLSLAPSF
GSLVALKELDMHGIFFRSLDETTLRPLAHLPVLQTLRLQMNFISQAQLGIFRAFPGLRYV
DLSDNRISGASELTATMQEVVGGEKVWLQPGDLAPAPVDTPSSEDFRPNCSTLNFTLDLS
RNNLVTVRPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTSLQVLDLSHNKLDLYHEHS
FTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL
RALDFSGNALGRMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPHTLDKLPKSLQVLHL
RDNYLAFFKWGNLIHLPKLKVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVDPGF
FSKAKELRELNLSANALKTVDPSWFGPLASALQILDVSANPLHCACGAAFIDFLLEVQAA
VPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFTLSLLSVALGLGVPMLHHLCG
WDLWYCFHLCLAWLPWRGRQSGQGEDALPYDAFVVFDKTQSAVADWVYNELRGQLEERRG
RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLE
DRKDVVVLVILSPDGRRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHF
YNRNFCQGPTAE
Download sequence
Identical sequences B3Y667
ENSMMUP00000016085 NP_001123903.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]