SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016259 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016259
Domain Number 1 Region: 17-110
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000511
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016259   Gene: ENSMMUG00000012380   Transcript: ENSMMUT00000017361
Sequence length 198
Comment pep:known_by_projection chromosome:MMUL_1:1:5669345:5671849:1 gene:ENSMMUG00000012380 transcript:ENSMMUT00000017361 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTVDLARVGACILKHAVTGEAVELRSLWRDRACVVAGLRRFGCVVCRWIAQDLSGLAGL
LEQHGVRLVGVGPEALGLQEFLDGGYFAGELYLDESKQLYKELGFKRYNSLSILPAALGK
PVRDVAAKAKAVGIQGNLSGDLLQSGGLLVVSKGGDKVLLHFVQKSPGDYVPQEHILQVL
GISAEVCASNPPQCDREV
Download sequence
Identical sequences ENSMMUP00000016259 XP_002801782.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]