SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016331 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016331
Domain Number 1 Region: 754-981
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 7.2e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 350-526
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.36e-57
Family Regulator of G-protein signaling, RGS 0.0000000151
Further Details:      
 
Domain Number 3 Region: 985-1119
Classification Level Classification E-value
Superfamily PH domain-like 1.37e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 35-121
Classification Level Classification E-value
Superfamily PDZ domain-like 8.15e-21
Family PDZ domain 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016331
Domain Number - Region: 151-160
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016331   Gene: ENSMMUG00000012436   Transcript: ENSMMUT00000017438
Sequence length 1562
Comment pep:known_by_projection chromosome:MMUL_1:1:135545307:135654742:-1 gene:ENSMMUG00000012436 transcript:ENSMMUT00000017438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGISGLQQDPFPAGAPRITPVIPQPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYSRNPASLLEEQIEGARRRVTQLQLKIQQETGGSVDILPLY
GDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNRNSILSDPGLDSPRTSPVIMA
RVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDPGYFNNESDIIFQDLEKLKSR
PAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRNLGKDIWNIFLEKNAPLRVKIP
EMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLD
GDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYMSHAGIRLREARPSNTAEKAQ
SAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYIGKPKSSSQSTFHIPLSPVEV
KPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLESDSSRSEIRLGRSESLKGREE
MKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSI
ESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVIN
ELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFPNLPELIEIHNSWCEAMKKLR
EEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQEA
ESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGTSEHEKLCRARDQCREILKYV
NEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLDLTTRKMIHEGPLTWRISKDK
TLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDK
RAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRNATRHPGAAPMPIHPPPPGPQ
EPAHQGLTPSRVELDDSDVFHGEPEPEELPGGTGPQQRVQGKHPVLLEDPEQEGSAEEEE
LGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADSALEDVENLRHLILWSLLPGH
TMETQAAREPEDDLTPTPSVISVTSHPWDPGSPGQAPPGGQGDNTQLAGPEGGRPEQEDV
GLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGYKVVRKAEVAGSKVVPALPES
GQPEPGPPEVEGGTKATGNCFYVSMPAGPLDSSTDHSGVPTSPPQPDSVPAGQAEPRPQL
QGGNGDPRRLSRSPPSLALRDVGMIFRTIEQLTLKLNRLKDMELAHRELLKSLGGESSGG
TTPVGSFHTEAARWTDGSLSPPTKEPLASDSRNSHELGPCPEDGSDAPLEDSAADAAASP
GP
Download sequence
Identical sequences ENSMMUP00000016331 9544.ENSMMUP00000016331 ENSMMUP00000016331 XP_001116843.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]