SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016333 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016333
Domain Number 1 Region: 714-941
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-59
Family DBL homology domain (DH-domain) 0.000000000823
Further Details:      
 
Domain Number 2 Region: 310-486
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 5.1e-57
Family Regulator of G-protein signaling, RGS 0.0000000151
Further Details:      
 
Domain Number 3 Region: 945-1079
Classification Level Classification E-value
Superfamily PH domain-like 1.34e-43
Family Pleckstrin-homology domain (PH domain) 0.000000248
Further Details:      
 
Domain Number 4 Region: 35-121
Classification Level Classification E-value
Superfamily PDZ domain-like 8.02e-21
Family PDZ domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016333   Gene: ENSMMUG00000012436   Transcript: ENSMMUT00000017440
Sequence length 1522
Comment pep:known_by_projection chromosome:MMUL_1:1:135545993:135654443:-1 gene:ENSMMUG00000012436 transcript:ENSMMUT00000017440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRLPQSIDRLSSLSSLGDSAPERKSPSHHRQPSDASETTGLVQRCVIIQKDQHGFGFT
VSGDRIVLVQSVRPGGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGISGLQQDPFPAGAPRITPVIPQPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQDILPLYGDTSQRPSEGRLSLDSQEGDSGLDSGTERFPSLSESLMNR
NSILSDPGLDSPRTSPVIMARVAQHHRRQGSDAAVPSTGDQGVDQSPKPLIIGPEEDYDP
GYFNNESDIIFQDLEKLKSRPAHLGVFLRYIFSQADPSPLLFYLCAEVYQQTSPKDSRNL
GKDIWNIFLEKNAPLRVKIPEMLQAEIDSRLRNSEDARGVLCEAQEAAMPEIQEQIHDYR
TKRTLGLGSLYGENDLLDLDGDPLRERQVAEKQLAALGDILSKYEEDRSAPMDFALNTYM
SHAGIRLREARPSNTAEKAQSAPDKDKWLPFFPKTKKSSNSKKEKDALEDKKRNPILKYI
GKPKSSSQSTFHIPLSPVEVKPGNVRNIIQHFENNQQYDAPEPGTQRLSTGSFPEDLLES
DSSRSEIRLGRSESLKGREEMKRSRKAENVPRSRSDVDMDAAAEATRLHQSASSSASSLS
TRSLENPTPPFTPKMGRRSIESPSLGFCTDALLPHLLEDDLGQLSDLEPEPDAQNWQHTV
GKDVVAGLTQREIDRQEVINELFVTEASHLRTLRVLDLIFYQRMKKENLMPREELARLFP
NLPELIEIHNSWCEAMKKLREEGPIIKEISDLMLARFDGPAREELQQVAAQFCSYQSIAL
ELIKTKQRKESRFQLFMQEAESHPQCRRLQLRDLIISEMQRLTKYPLLLESIIKHTEGGT
SEHEKLCRARDQCREILKYVNEAVKQTENRHRLEGYQKRLDATALERASNPLAAEFKSLD
LTTRKMIHEGPLTWRISKDKTLDLHVLLLEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQ
TFSPVLKLNAVLIRSVATDKRAFFIICTSKLGPPQIYELVALTSSDKNTWMELLEEAVRN
ATRHPGAAPMPIHPPPPGPQEPAHQGLTPSRVELDDSDVFHGEPEPEELPGGTGPQQRVQ
GKHPVLLEDPEQEGSAEEEELGVLPCPSTSLDGENRGIRTRNPIHLAFPGPLFMEGLADS
ALEDVENLRHLILWSLLPGHTMETQAAREPEDDLTPTPSVISVTSHPWDPGSPGQAPPGG
QGDNTQLAGPEGGRPEQEDVGLCSLEHLPPRTRNSGIWESPELDRNLAEDASSTEAAGGY
KVVRKAEVAGSKVVPALPESGQPEPGPPEVEGGTKATGNCFYVSMPAGPLDSSTDHSGVP
TSPPQPDSVPAGQAEPRPQLQGGNGDPRRLSRSPPSLALRDVGMIFRTIEQLTLKLNRLK
DMELAHRELLKSLGGESSGGTTPVGSFHTEAARWTDGSLSPPTKEPLASDSRNSHELGPC
PEDGSDAPLEDSAADAAASPGP
Download sequence
Identical sequences XP_001116835.1.72884 ENSMMUP00000016333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]