SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016385 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016385
Domain Number 1 Region: 908-1220
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.35e-111
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000000000161
Further Details:      
 
Domain Number 2 Region: 1185-1473
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.21e-101
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000000000619
Further Details:      
 
Domain Number 3 Region: 267-465
Classification Level Classification E-value
Superfamily Fibronectin type III 1.11e-39
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 4 Region: 51-153
Classification Level Classification E-value
Superfamily Immunoglobulin 8.22e-19
Family I set domains 0.003
Further Details:      
 
Domain Number 5 Region: 154-248
Classification Level Classification E-value
Superfamily Immunoglobulin 4.44e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 6 Region: 528-572
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000178
Family Fibronectin type III 0.0044
Further Details:      
 
Domain Number 7 Region: 580-669
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000755
Family Fibronectin type III 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016385   Gene: ENSMMUG00000012477   Transcript: ENSMMUT00000017495
Sequence length 1481
Comment pep:known_by_projection chromosome:MMUL_1:1:46453563:46534614:1 gene:ENSMMUG00000012477 transcript:ENSMMUT00000017495 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPLQVDCPGLWLAVELEPWMAPEPAPGRTMVPLVPALVMLGLVAGAHGDSKPVFIKVPED
QTGLSGGVASFVCQATGEPKPRITWMKKGKKVSSQRFEVIEFDDGAGSVLRIQPLRVQRD
EAIYECTATNSLGEINTSAKLSVLEEEQLPPGFPSIDMGPQLKVVEKARTATMLCAAGGN
PDPEISWFKDFLPVDPATSNGRIKQLRSGALQIESSEESDQGKYECVATNSAGTRYSAPA
NLYVRVRRVAPRFSIPPSSQEVKTQQGVPAQPADFQAEVESDTRIQLSWLLPPQERIIMY
ELVYWVAEDEDQQHKVTFDPTSSYTLEDLKPDTLYRFQLAARSDMGVGVFTPTIEARTAQ
STPSAPPQKVMCVSTGSTTVRVSWVPPPADSRNGVITQYSVAYEAVDGEDRRRHVVDGIS
REHSSWDLVGLEKWTEYRVWVRAHTDVGPGPESSPVLVRTDEDAPLPPSKPKIVKASVAA
LSQPWRTQLVLSEAGIQIFELGVVLGPKSPPSSFTILSPFLSLSRGQWRPEESEDYETTI
SGLTPETTYSITVAAYTTKGDGARSKPKIVTTTGAVFAKNFRVAAAMKTSVLLSWEVPDS
YKSAVPFKILYNGQSVEVDGHSMRKLIADLQPNTEYSFVLMNRGSSAGGLQHLVSIRTAP
DLLPHKPLPASAYIEDGRFALSMPHVQDPSLVRWFYIVVVPIDRVGGSMLAPRWSTPEEL
ELDELLEAIEQGGEEQRRRRRQAERLKPYVAAQLDVLPKTFTLGDKKNYRGFYNRPLSPD
LSYQCFVLASLKEPMDQKRYASSPYSDEIVVQVTPAQQQEEPEMLWVTGPVLAVILIILI
VIAILLFKRKRTHSPSSKDEQSIGLKDSLLAHSSDPVEMRRLNYQTPGSSVPSCPNTSSM
RDHPPIPITDLADNIERLKANDGLKFSQEYESIDPGQQFTWENSNLEVNKPKNRYANVIA
YDHSRVILTSIDGVPGSDYINANYIDGYRKQNAYIATQGPLPETMGDFWRMVWEQRTATV
VMMTRLEEKSRVKCDQYWPARGTETYGLIQVTLLDTVELATYTVRTFALHKSGSSEKREL
RQFQFMAWPDHGVPEYPTPILAFLRRVKACNPLDAGPMVVHCSAGVGRTGCFIVIDAMLE
RMKHEKTVDIYGHVTCMRSQRNYMVQTEDQYVFIHEALLEAATCGHTEVPARNLYAHIQK
LGQVPPGESVTAMELEFKLLASSKAHTSRFISANLPCNKFKNRLVNIMPYELTRVCLQPI
RGVEGSDYINASFLDGYRQQKAYIATQGPLAESTEDFWRMLWEHNSTIIVMLTKLREMGR
EKCHQYWPAERSARYQYFVVDPMAEYNMPQYILREFKVTDARDGQSRTIRQFQFTDWPEQ
GVPKTGEGFIDFIGQVHKTKEQFGQDGPITVHCSAGVGRTGVFITLSIVLERMRYEGVVD
MFQTVKTLRTQRPAMVQTEDQYQLCYRAALEYLGSFDHYAT
Download sequence
Identical sequences ENSMMUP00000016385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]