SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016585 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016585
Domain Number 1 Region: 7-127
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.37e-20
Family DsbA-like 0.00000488
Further Details:      
 
Domain Number 2 Region: 177-267
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000000716
Family DsbA-like 0.0000276
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016585   Gene: ENSMMUG00000012628   Transcript: ENSMMUT00000017710
Sequence length 273
Comment pep:known scaffold:MMUL_1:1099548049365:34111:39772:1 gene:ENSMMUG00000012628 transcript:ENSMMUT00000017710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPLLRTVELFYDVLSPYSWLGFEVLCRYQNIWNINLQLRPSLIGGIMKDSGNKPPGLLP
RKGQYMANDIKLLRHHFQIPIQFPKDFFSVIIEKGSLSAMRFLTAVSLEHPEMLEKASRE
LWMRVWSRVSVGLWESSGRTFDDFLTFPRNVFRVMILPSPLPQRIYCPPVTPLSFDEDIT
QPQSILAAAEKAGMSAEQAQGLLEKISTPKVKNQLKETTEAACRYGAFGLPITVAHVDGQ
THMIFGSDRMELLAFLLGEKWMGPVPPAVNARL
Download sequence
Identical sequences G7MN06
ENSMMUP00000016585 9544.ENSMMUP00000016585 ENSMMUP00000016585

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]