SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016742 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016742
Domain Number 1 Region: 47-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.51e-38
Family SCAN domain 0.0000565
Further Details:      
 
Domain Number 2 Region: 532-588
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 643-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 475-532
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.83e-23
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 587-644
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 7 Region: 685-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.09e-18
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 166-223
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.63e-17
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000016742
Domain Number - Region: 365-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000287
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number - Region: 311-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0744
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016742   Gene: ENSMMUG00000012745   Transcript: ENSMMUT00000017878
Sequence length 744
Comment pep:known chromosome:MMUL_1:15:24638654:24654892:-1 gene:ENSMMUG00000012745 transcript:ENSMMUT00000017878 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAVVPLNKMTAISPDPQTLASTEQNEVPRVVTSGEQEAILRGNAADAESFRQRFRWFCY
SEVAGPRKALSQLWELCIQWLRPDIHTKEQILELLVFEQFLTILPGEIRIWVKSQHPESS
EEVVTLIEDLTQMLEEKDPVSQDSTVSQEENSKEDKMVAVCPNTESRESITLKDVAVNFS
RGEWKKLEPFQKELYKEVLLENFRNLEFLDFPVSKLELISQLKWVELPWLLEEVSKGSRP
DESALDKIIERCLRDDDYGLMEEFQQYCGSSEDDHGNQGNSKGTVTQNKTRGSGSRGEEF
DPGKSPFGHNFKETSDLIKHLKVYLRKKSRRYNESKKPFSFHSDLVLNRKEKTTGEKSRK
SNDGGKVLSHSSALTEHQKRQKIHLGDRSQKCSKCGIIFIRRSTLSRRKIPMCEKCRKDS
CQEAALNKDEGNETGEKTHKCSKCGKAFGYSASLTKHRRIHTGEKPYMCNECGKAFSDSS
SLTPHHRTHSGEKPFKCDDCGKGFTLSAHLIKHQRIHTGEKPYKCKDCGRPFSDSSSLIQ
HQRIHTGEKPYTCNNCGKSFSHSSSLSKHQRIHTGEKPYKCGECGKAFRQNSCLTRHQRI
HTGEKPYLCNDCGMTFSHFTSVIYHQRLHSGEKPYKCNQCEKAFPTHSLLSRHQRIHTGV
KPYKCKECGKSFSQSSSLNEHHRIHTGEKPYECNYCGATFSRSSILVEHLKIHTGRREYE
CNECEKTFKSNSGLIRHRGFHAAE
Download sequence
Identical sequences A0A1D5RKV2 G8F3G3
ENSMMUP00000016742 9544.ENSMMUP00000016742 XP_001105826.1.72884 XP_005581133.1.63531 ENSMMUP00000016742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]