SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016757 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016757
Domain Number 1 Region: 330-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.75e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 1-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.37e-24
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 4 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 5 Region: 271-326
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.35e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 178-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.44e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 481-533
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.17e-16
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 9 Region: 141-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000692
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016757   Gene: ENSMMUG00000012753   Transcript: ENSMMUT00000017895
Sequence length 535
Comment pep:known_by_projection chromosome:MMUL_1:19:22740280:22752455:1 gene:ENSMMUG00000012753 transcript:ENSMMUT00000017895 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEPLKFRDVAVEFSLEEWQCLDTIQQNLYRNVMLENYRNLVFLGIAVSKPDLITCLEQEK
EPWTRKRHRMVAKPAPVTCSHFAQDFSPEQNIKDSFQKVTLRRHGKCEHENLQLRKCGKS
VDECKVQKGGYNGLNQCLPATQSKLFHCDEYMKIFHKFSNLNGHKIRHTGKKPFKLNFYK
CEDCGKAFNGSLIFTKHKRIHNGEKPYKCEECGKAFNLSSHITTHKIIHTGEKAYKCEEC
GKAFNQSSHLTRHKIIHTGEKPYKCEECGKAFRQSSHLTTHKMIHTGEKPYKCEECGKAF
NKSSHLTRHKSIHAGEKPYQCEKCGKTSNQSSNLTEHKNIHTEEKPYKCEECGKAFKQLS
NLTTHKRIHTGEKPYKCEECGKAFNQSSILTTHKRIHTGEKSYKCEECGKAFYRSSKLTE
HKKIHTREKRYTCEECGKAFNHSSHLTTHKVIHTGEKFYQCEECGKAFNQSSHLTRHKRI
HTGEKPYQCEKCGKAFNQSSNLTVHKKIHTGEKLYKPKRCNSGFENTSNFSKHKR
Download sequence
Identical sequences ENSMMUP00000016757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]