SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016768 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016768
Domain Number 1 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.27e-26
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.08e-24
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 3 Region: 371-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.62e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 4 Region: 595-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.47e-21
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 5 Region: 24-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 651-707
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-19
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 7 Region: 329-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.29e-18
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 8 Region: 288-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000428
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 9 Region: 502-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000147
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 10 Region: 419-449
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000105
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 11 Region: 233-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000163
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016768   Gene: ENSMMUG00000012764   Transcript: ENSMMUT00000017906
Sequence length 711
Comment pep:known chromosome:MMUL_1:19:57645463:57656661:1 gene:ENSMMUG00000012764 transcript:ENSMMUT00000017906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPADVNLSQKPQVLGPEEQDGSCEASLSFEDVTVDFSREEWQQLDPAQRRLYQDVTLELY
SHLFSVGYHIPNPDVIFRMLKEKEPCVEEAELSHQRCQEGEFGLEIPQKEISKKASFQKD
MVGEFTRDGSWCSILEELRLDTDRTKKDKQNQIQPMSHSAFFNKKTLNTESNCEYKDPGK
MIHTRPHLASSQEQPQKCCLFTKSLKLNLEVSGQNENNDTKQLDDVVGSGQLFNHSSSHA
CSKNIHTGETFCKGNQCRKVCGHKQSLTQHQIHTQKKPDGCSECGRDFTPKSHLFAQQRI
HSVGNLHECGRCGKAFTPQLKLSVYLTDHTGDIPYICKECGKVFIQRSELVTHQKTHTRK
KPYECHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGFSQNSTLIIHQKIHTGERQYA
CSECGKAFTQKSTLSLHQRIHSGQKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHNC
GKSFISKSQLDIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCGECGKAF
NQKSILSMHQRIHTGEKPYKCSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRS
NFHKHQVTHTRERPFVCSKCGKAFVQKSELITHQRTHMGEKPYECLDCGKSFSKKPQLKV
HQRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYKCSYSVKGFTKQ
Download sequence
Identical sequences A0A1D5Q154
ENSMMUP00000016768 ENSMMUP00000016768 9544.ENSMMUP00000016768 NP_001247959.1.72884 XP_014979922.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]