SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016774 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016774
Domain Number 1 Region: 170-307
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.55e-35
Family cAMP-binding domain 0.000000241
Further Details:      
 
Domain Number 2 Region: 4-149
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000000000000157
Family Voltage-gated potassium channels 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016774   Gene: ENSMMUG00000012768   Transcript: ENSMMUT00000017913
Sequence length 366
Comment pep:novel chromosome:MMUL_1:19:339864:355336:1 gene:ENSMMUG00000012768 transcript:ENSMMUT00000017913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QIFHMTYDLASAVMRICNLISMMLLLCHWDGCLQFLVPMLQDFPRNCWVSINGMVNHSWS
ELYSFALFKAMSHMLCIGYGRQAPESMTDIWLTMLSMIVGATCYAMFIGHATALIQSLDS
SRRQYQEKGRQAQPWEAGPALGSEARGRLGPPPSSKWHAQGTDSVMGRVGGPRKGEIVNF
NCRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLT
KGNKEMKLSDGSYFGEICLLTRGRRTSSVRADIYCRLYLLSVDNFNEVLEEYPMMRRAFE
TVAIDRLDRIGKKNSILLHKVQHDLNSGVFNNQENAIIQEIVKYDREMVQQAELGQRVGL
FPPPPP
Download sequence
Identical sequences ENSMMUP00000016774 ENSMMUP00000016774 9544.ENSMMUP00000016774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]