SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016805 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016805
Domain Number 1 Region: 526-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.28e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 638-694
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 582-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-24
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 4 Region: 358-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.56e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 5 Region: 470-526
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-22
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 414-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.83e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 7 Region: 694-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 8 Region: 17-78
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.29e-20
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 9 Region: 735-787
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.73e-19
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 10 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.39e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 221-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000615
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 12 Region: 276-330
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000174
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016805   Gene: ENSMMUG00000012793   Transcript: ENSMMUT00000017946
Sequence length 796
Comment pep:known_by_projection chromosome:MMUL_1:19:50642941:50661231:1 gene:ENSMMUG00000012793 transcript:ENSMMUT00000017946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSQDYDLPQKEQEKMTKFQDAVTFKDVAVVFSREELRLLDLTQRKLYRDVMVENFKNLV
AVGHLPFQPDMVSQLEAEEKLWMMETETQRSSKHQNKMETLQKFALKYLSNQELSCWQIW
KQVARELTRCLQGKSSQLLQGDSIQVSENENNIMNPKGIYIENQEFSFWRTQHSCRNIYL
SESQIQSRGKQINVKNNLHIHEDFMKKSPFHEHIKTDTEPKPCKGNEYGKIISDGINQKL
PLGEKPHPCGECGRGFSYSPGFPLHQNVHTGEKCLSQSSHLQTLQRIHPGEKLNRCHESG
DCFNKSSFHSYQSNHTGEKSYRCDSCGKGFSSSTGLIIHYRTHTGEKPYKCEECGKCFSQ
SSNFQCHQRVHTEEKPYKCEECGKGFGWSVNLRVHQRVHRGEKPYKCEECGKGFTQAAHF
HIHQRVHTGEKPYKCDVCGKGFSHNSPLICHRRVHTGEKPYKCEACGKGFTRNTDLHIHF
RVHTGEKPYKCKECGKGFSQASNLQVHQNVHTGEKRFKCETCGKGFSQSSKLQTHQRVHT
GEKPYRCDVCGKDFSYSSNLKLHQVIHTGEKPYKCEECGKGFSWRSNLHAHQRVHSGEKP
YKCEQCDKSFSQAIDFRVHQRVHTGEKPYKCGVCGKGFSQSSGLQSHQRVHTGEKPYKCD
VCGKGFRYSSQFIYHQRGHTGEKPYKCEECGKGFGRSLNLRHHQRVHTGEKPHICEECGK
AFSLPSNLRVHLGVHTREKLFKCEECGKGFSQSARLQAHQRVHTGEKPYKCDICDKDFRH
RSRLTYHQKVHTGKKL
Download sequence
Identical sequences A0A1D5QXD9
9544.ENSMMUP00000016805 XP_001102642.2.72884 XP_014979697.1.72884 XP_014979698.1.72884 ENSMMUP00000016805 ENSMMUP00000016805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]