SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016814 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016814
Domain Number 1 Region: 630-687
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.69e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 519-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.51e-25
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 3 Region: 575-631
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.07e-24
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 407-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.34e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 5 Region: 463-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-22
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.62e-22
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 8 Region: 309-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.19e-18
Family Classic zinc finger, C2H2 0.0065
Further Details:      
 
Domain Number 9 Region: 676-728
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.92e-17
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 10 Region: 228-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000496
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016814   Gene: ENSMMUG00000012801   Transcript: ENSMMUT00000017955
Sequence length 733
Comment pep:known_by_projection chromosome:MMUL_1:19:50712216:50728817:-1 gene:ENSMMUG00000012801 transcript:ENSMMUT00000017955 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EAVTFKDVAVAFTEEELGLLDSAQRKLYRDVMLENFRNLVSVGHQSFKPDMISQLEREEK
LWMKEFQTQRGKHSGDRNQNEMATLHKAGLRCFSLGELSCWQIKRHVVSKLARSQDSMIN
IEGKSSEFPKHHDSPCQVGAGESVQASVDDSLLVNHVGDHSRIIENQEFPTGKVPNSWSK
IYLNETQNYQRSCKQTQMKNQLCIFAPYVDIFSCISHHRDDKILHKRDKAYSNSDCGKDT
LKVSPLTQCSVHTGQKTYQGNECEEAFNDSSSLEFHKQVHLRKKSPAYSTHEKDTSHSSR
IPVQQSVRTGKKRYWCHECGKGFSQSSNLQTHQRVHTGEKPYTCHECGKSFNQSSHLYAH
LPIHTGEKPYRCDSCGKGFSRSTDLNIHCRVHTGEKPYKCEVCGKGFTQRSHLQAHERIH
TGEKPYKCGDCGKRFSCSSNLHTHQRVHTEEKPYKCDECGKCFSLSFNLHSHQRVHTGEK
PYKCEECGKGFSSASSFQSHQRVHTGEKPFRCNVCGKGFSQSSYFQAHQRVHTGEKPYKC
EVCGKRFNWSLNLHNHQRVHTGEKPYKCEECGKGFSQASNLQAHQSVHTGEKPFKCDACQ
KRFSQASHLQAHQRVHTGEKPYKCDTCGKAFSQRSNLQVHQIIHTGEKPFKCEECGKEFS
WSAGLSAHQRVHTGEKPYTCQQCGKGFSQASHFHTHQRVHTGERPYICDVCCKGFSQRSH
LVYHQRVHTGGNL
Download sequence
Identical sequences ENSMMUP00000016814 9544.ENSMMUP00000016814 ENSMMUP00000016814

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]