SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016818 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016818
Domain Number 1 Region: 562-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 2 Region: 618-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 3 Region: 506-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 4 Region: 674-730
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 827-879
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.85e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 786-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-21
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 730-786
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.42e-21
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 
Domain Number 9 Region: 395-452
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000121
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 315-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000768
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 11 Region: 440-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000032
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 244-293
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000705
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016818   Gene: ENSMMUG00000012802   Transcript: ENSMMUT00000017959
Sequence length 913
Comment pep:known chromosome:MMUL_1:19:50744648:50776498:-1 gene:ENSMMUG00000012802 transcript:ENSMMUT00000017959 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKFQEMVTFKDVAVVFTEEELGLLDSVQRKLYRDVMLENFRNLLLVAHQPFKPDLISQL
EREEKLLMVETETPKDGCSGRKNQQKMESIQEVTVSYLSPKELSSCQTWQQSAGGLIRCQ
DFLKVFQGKNSQLQEQGDSLCQVWAGIPVQISEDENYILTHIGNGSNYIKSQEYPSWRAH
HSWRKMYLKESCNYQCRCQQISMKNNFCKCDSVSWISHHNDKLEVHRKENYSCHDCGEDI
VKVSLFNQDSIQTEEKPYPCTGYRKAFNNDSSSEVHQQFHLKGKPYTYSSHGKGCSYSSL
LHHHQNIQREDDIENSHLKSYQRVHTEEKPCKCSEYGGNFNHYSPLNTYELIHTGEMSYR
HNIYEKAFSHSLDLNSIFRVHTRDEPHEYEENENVFNQSSCLQVHQKIHTEEKLYTDVEY
GKSFICSSNLDIQHRVHMEENSYNSEECGNDFSLASHFQDLQIVHTKEQPYKRYVCGNSF
SHSLYLQGHPKIHIGEKPHKDCGNGFNWSSKLKDHQRVHTGQKPYKCNICGKGFNHRSVL
NVHQRVHTGEKPYKCEECDKGFSRSSYLQAHQRVHTGEKPYKCEECGKGFSRNSYLQGHQ
RVHTGEKPYKCEECGKGFSRSSHLQGHQRVHTGEKPFKCEECGKGFSWSFNLQIHQRVHT
GEKPYKCEECGKGFSKASTLLAHQRVHTGEKPYQCDECGKSFSQRSYLQSHQSVHSGERP
YICEVCGKGFSQRAYLQGHQRVHTRVKPYKCEMCGKGFSQSSRLEAHRRVHTGGKPYKCE
VCTKGFSESSRLQAHQRVHAEGRPYKCEQCGKGFSGYSSLQAHHRVHTGEKPYKCEVCGK
GFSQRSNLQAHQRVHTGEKPYKCDACGKGFRWSSGLLIHQRVHTSDKFYRSEDFGKDYPS
SENLHRNEDSVLF
Download sequence
Identical sequences ENSMMUP00000016819 ENSMMUP00000016818 9544.ENSMMUP00000016818

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]