SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000016899 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000016899
Domain Number 1 Region: 210-319
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.5e-34
Family PDI-like 0.0037
Further Details:      
 
Domain Number 2 Region: 72-180
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.35e-33
Family PDI-like 0.0021
Further Details:      
 
Domain Number 3 Region: 331-440
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000571
Family DsbC/DsbG C-terminal domain-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000016899   Gene: ENSMMUG00000012864   Transcript: ENSMMUT00000018049
Sequence length 491
Comment pep:known chromosome:MMUL_1:13:10877240:10912635:-1 gene:ENSMMUG00000012864 transcript:ENSMMUT00000018049 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RRDLQEKLVRVCRPPAPVEVPANISSDFQPSPESSPAHSLSKKSPIRYPSTTMVNAPSLV
SCAFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAA
TALKDVVKVGAVDADKHQSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALS
ALRQLVKDRLGGRSGGYSSGKQGRSDSSSKKDVIELTDDSFDENVLDSEDVWMVEFYAPW
CGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESP
VDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKRTCEEHQLCVVAVLPHILDTG
AAGRNSYLEVLLKMADKYKKKMWGWLWTEAGAQSELETALGIGGFGYPAMAAINARKMKF
ALLKGSFSEQGINEFLRELSFGRGSTAPVGGGAFPTIVEREPWDGRDGELPVEDDIDLSD
VELDDLGKDEL
Download sequence
Identical sequences 9544.ENSMMUP00000016899 ENSMMUP00000016899 ENSMMUP00000036757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]