SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017052 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017052
Domain Number 1 Region: 46-216,264-335
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.41e-36
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 2 Region: 1152-1206,1233-1430
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-31
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 3 Region: 813-987,1027-1103
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.63e-25
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 526-666
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000102
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017052
Domain Number - Region: 1437-1516
Classification Level Classification E-value
Superfamily EF-hand 0.00148
Family Calmodulin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017052   Gene: ENSMMUG00000008618   Transcript: ENSMMUT00000018214
Sequence length 1622
Comment pep:novel chromosome:MMUL_1:X:47061514:47083684:-1 gene:ENSMMUG00000008618 transcript:ENSMMUT00000018214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPKRRNQHSKHKTVAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANC
VALGVYIPFPEDDSNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLL
DFIIVVVGLFSVLLEQGPGRPGDAPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIV
LNSIMKALVPLLHIALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSADLEAEEDPSPCAS
SGSGRACTLNQTECRGRWPGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGY
ELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKQREKQQMEEDLRGYL
DWITQAEELDMEDPSADGNLGSMASLPASDTGSMTETQGDEDEEEGALASCTRCLNKIMK
TRVCRRLRRANRVLRARCRRAVKSNACYWAVLLLVFLNTLTIASEHHGQPVWLTQIQGTP
PACQSSPPASYSFYPRSLNPGPLRLHNEPPCPASPTSYSHLTPTPKSVLTLTPKLYEPNL
PRHWASLSNLVASLLNSMKSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFD
TFPQALLTVFQILTGEDWNVVMYDGIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLASGDAGTAKDKESLTGNPSDTPTTRDASRHPGNPHLQIPSASRRFYGTQERSVL
TVSIPLCPSAAITPISSHREKSSEKDLPPENEGLVPGVEKEEEEGTRSAGGVELLQEVVP
KEKVVPIPEGSAFFCLSQTNPLRKGCHTLIHHHVFTNLILVFIILSSVSLAAEDPIRAHS
FRNHVSLWLGADAVSAFTLFLTPQILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRS
WFNMLDLLVVSVSLISFGIHSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIR
TIGNIMIVTTLLQFMFACIGVQLFKGKFYTCTDEAKHTPQECKGSFLVYPDGDVSRPLVR
ERLWVNSDFNFDNVLSAMMALFTVSTFEGWPALLYKAIDAYAEDHGPIYNYRVEISVFFI
VYIIIIAFFMMNIFVGFVIITFRAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNP
HQYRVWATVNSAAFEYLMFLLILLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTIEMV
LKIIAFKPKSSGVGDVGSNQGVSLGKDRALLFSCLQHYFTDAWNTFDALIVVGSVVDIAV
TEVNPSPQSSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLI
AMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLP
GNRCDPESDFGPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSIL
GPHHLDEFKRIWSEYDPGAKGHIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMP
LNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKRMKQKLLDEVIPPPD
EEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGNEAAPSTSSALQAGLRSLQDLGPEMRQA
LT
Download sequence
Identical sequences ENSMMUP00000017052

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]