SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017054 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017054
Domain Number 1 Region: 1207-1289,1335-1489
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 6.04e-35
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Domain Number 2 Region: 889-1042,1082-1160
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.51e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 3 Region: 113-281,330-401
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-28
Family Voltage-gated potassium channels 0.016
Further Details:      
 
Domain Number 4 Region: 512-745
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.12e-27
Family Voltage-gated potassium channels 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017054   Gene: ENSMMUG00000012988   Transcript: ENSMMUT00000018216
Sequence length 2165
Comment pep:known chromosome:MMUL_1:11:2204275:2789343:1 gene:ENSMMUG00000012988 transcript:ENSMMUT00000018216 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTV
SSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISIVEWKYPLPFEIIILLT
IFANCVALAIYIPFPEDDSNATNSNLERSELFFLNVFLVETGLPVIQLGLLFHPRAGYLR
NTWKFFLYFLVEMGLFSAILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDD
PSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWV
NDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEE
DLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGAR
LAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWL
TEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVCGGILETILVETKIMS
PLGISVLRCVRLLRIFKITRYRASPLTLERGLREKLNSVSSMLHLLFSLSHLQSLFKMQL
FGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIY
FIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEMVE
KPAVEESKEEKIELKSITADGESPPTTKINMDDLQPNENEDKSPYPNPETTGEEDEEEPE
MPVGPRPRPLSELHLKEKAVPMPEASAFFVFSSNNRFRLQCHRIVNDTIFTNLILFFILL
SSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLHKGSFCRNYFNIL
DLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNI
VIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWE
NSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIII
IAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKV
WYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIA
FKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMGPFCSHPPLAVLTAPPV
ADGFQNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVML
FFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKK
CAPESEPGNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILG
PHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPL
NSDGTVMFNATLFALVRTALRIKTEEGPSPSEAHQGAEDPFRPAGNLEQANEELRAIIKK
IWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSL
QAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQ
SDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNAN
NTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAWKLSSKRCHSGESQTAMVGPEET
SQDETYEVKMNHDAEACSEPSLLSTDINYQNAPNHSLTRPSMSASVLFSCPDPGSLAGFA
GRRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFA
TPPATPGSRGWPPQPIPTLRLEGAESSEKLNSSFPSIHCGSWAETTPGGGDSNTTRRARP
VSLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEE
MESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCARARGRLSEEELQDSRV
YVSSL
Download sequence
Identical sequences ENSMMUP00000017054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]