SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017317 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017317
Domain Number 1 Region: 1-355
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.23e-63
Family GDI-like N domain 0.000000000256
Further Details:      
 
Domain Number 2 Region: 389-434
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000000181
Family GDI-like N domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017317   Gene: ENSMMUG00000013182   Transcript: ENSMMUT00000018493
Sequence length 445
Comment pep:known chromosome:MMUL_1:9:6039743:6088787:-1 gene:ENSMMUG00000013182 transcript:ENSMMUT00000018493 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPG
SPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVP
STEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMREVYKKFDLGQD
VIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFAR
LSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRV
ICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETK
EPEKEIRPALELLEPIEQKFVSISDLLVPKDLGMESQIFISRTYDATTHFETTCDDIKNI
YKRMTGSEFDFEEMKRKKNDIYGED
Download sequence
Identical sequences A0A2I3MLM6 A0A2K5NBY8 A0A2K5UTB9 A0A2K6BHA9 A0A2K6P708 F6XQP2
ENSPANP00000019845 ENSMMUP00000017317 ENSMMUP00000017317 NP_001245097.1.72884 XP_005564626.1.63531 XP_010364805.1.97406 XP_011761034.1.29376 XP_011812458.1.43180 XP_011830312.1.47321 XP_011941111.1.92194 XP_017727935.1.44346 9544.ENSMMUP00000017317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]