SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017463 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017463
Domain Number 1 Region: 463-520
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.68e-19
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 2 Region: 505-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 138-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-17
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 4 Region: 406-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000359
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 5 Region: 367-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000572
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 6 Region: 339-383
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000011
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000017463
Domain Number - Region: 50-121
Classification Level Classification E-value
Superfamily Tropomyosin 0.000333
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017463   Gene: ENSMMUG00000013278   Transcript: ENSMMUT00000018643
Sequence length 557
Comment pep:known chromosome:MMUL_1:3:186467236:186493803:1 gene:ENSMMUG00000013278 transcript:ENSMMUT00000018643 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAPTSEWDSECLTSLQPLPLPTPPAANEAHLQTAAISLWTVVAAVQAIERKVEVH
SRRLLHLEGRTGTAEKKLASCEKTVTELGNQLEGKWAVLGTLLQEYGLLQRRLENLENLL
RNRNFWILRLPPGIKGDIPKVPVAFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLI
SMDYAINQPDVLSQIQPEGEHNTEDQAGPEESEIPADPSEEPGISTSDILSWIKQEEEPQ
VGAPPESKESDVYKSTYADEELVIKAEGLARSSLCPEVPVPFSSPPATAKDAFSDVAFKS
QQSTSMTPFGRPATDLPEASEGQVTFTQLGSYPLPPPVGEQVFSCHHCGKSLSQDMLLTH
QCSHATEHPLPCAQCPKHFTPQVDLSSTSQDHASETPPTCPHCARTFTHPSRLTYHLRVH
NSTERPFPCPDCPKRFADQARLTSHRRAHASERPFRCAQCGRSFSLKISLLLHQRGHAQE
RPFSCPQCGIDFNGHSALIRHQMIHTGERPYPCTDCSKSFMRKEHLLNHRRLHTGERPFS
CPHCGKSFIRKHHLMKH
Download sequence
Identical sequences 9544.ENSMMUP00000017463 ENSMMUP00000017463 ENSMMUP00000017463

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]