SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017826 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017826
Domain Number 1 Region: 5-94
Classification Level Classification E-value
Superfamily Dcp2 domain-like 6.28e-30
Family Dcp2 box A domain 0.00026
Further Details:      
 
Domain Number 2 Region: 97-206
Classification Level Classification E-value
Superfamily Nudix 2.03e-23
Family mRNA decapping enzyme-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017826   Gene: ENSMMUG00000013553   Transcript: ENSMMUT00000019031
Sequence length 418
Comment pep:known_by_projection chromosome:MMUL_1:6:109287726:109323467:1 gene:ENSMMUG00000013553 transcript:ENSMMUT00000019031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METKRVEIPGSVLDDLCSRFILHIPSEERDNAIRVCFQIELAHWFYLDFYMQNTPGLPQL
TSLTLFILFSHCPFLLPQGEDVEKVLDEWKEYKMGVPTYGAIILDETLENVLLVQGYLAK
SGWGFPKGKVNKEEAPHDCAAREVFEETGFDIKDYICKDDYIELRINDQLARLYIIPGIP
KDTKFNPKTRREIRNIEWFSIEKLPCHRNDMTPKSKLGLAPNKFFMAIPFIRPLRDWLSR
RFGDSSDSDNGFSSTGSTPAKPTVEKLSRTKFRHSQQLFPDGSPGDQWVKHRQSLQQKPY
NNHSEMSDLLKGKNQSVRGNGRKQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQ
DNFETAVYDLPSSNEDQLLEHAEGQPVACNGHCKFPFSSRAFLSFKFDHNAIMKILDL
Download sequence
Identical sequences ENSMMUP00000017826 9544.ENSMMUP00000017826 ENSMMUP00000017826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]