SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000017945 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000017945
Domain Number 1 Region: 13-40,89-164
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.57e-24
Family Voltage-gated potassium channels 0.0038
Further Details:      
 
Domain Number 2 Region: 151-224
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 8.37e-16
Family Voltage-gated potassium channels 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000017945   Gene: ENSMMUG00000013648   Transcript: ENSMMUT00000019162
Sequence length 320
Comment pep:known_by_projection chromosome:MMUL_1:4:39150819:39158209:-1 gene:ENSMMUG00000013648 transcript:ENSMMUT00000019162 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNAGLCSCWGGRVLPLLLVYVCYLLLGATIFQLLERQAEAQSRYHFQLEKLRFLENYTC
LDQWALEQFVQVIMEAWVKGVNPKGNSTNPSNWDFGSSFFFAGTVVTTIGYGNLAPSTEA
GQVFCVFYALLGIPLNVIFLNHLGMGLRAHLATIERWEDRPRRSKVLQVLGLALFLTLGT
LVILIFPPMVFSHVEGWSFSEGFYFAFITLSTIGFGDYVVGHPLNFITPGLLPSQEPFQT
PPGKPESQQIPGSFQKVRSMDIWPLSGIHYPDLAFPLPDCNIPDQKERFRPLHPEAWKLW
PLPLPPSNSKRAPTWLGSSA
Download sequence
Identical sequences 9544.ENSMMUP00000017945 ENSMMUP00000017945 ENSMMUP00000017945

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]