SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018128 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018128
Domain Number 1 Region: 179-306
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.75e-40
Family PLC-like (P variant) 0.0029
Further Details:      
 
Domain Number 2 Region: 1592-1737
Classification Level Classification E-value
Superfamily PH domain-like 3.54e-36
Family Phosphotyrosine-binding domain (PTB) 0.00000689
Further Details:      
 
Domain Number 3 Region: 12-177
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.77e-31
Family Dual specificity phosphatase-like 0.00012
Further Details:      
 
Domain Number 4 Region: 1440-1582
Classification Level Classification E-value
Superfamily SH2 domain 2.83e-22
Family SH2 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018128   Gene: ENSMMUG00000013785   Transcript: ENSMMUT00000019357
Sequence length 1742
Comment pep:known_by_projection chromosome:MMUL_1:12:81615570:81709566:-1 gene:ENSMMUG00000013785 transcript:ENSMMUT00000019357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSKHGGNYLLFNL
SEWRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTWLNADPHNVVVLHNKGNRGRI
GVVIAAYMHYSNISASADQALDRFAMKRFYEDKIVPIGQPSQRRYVHYFSGLLSGSIKMN
NKPLFLHHVIMHGIPNFESKGGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGL
LLKGDILLKCYHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV
EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDCMEEVVGHTQGP
LDGSLYAKVKKKDSLHGSTGAVNATRPTLSATPNHVEHTLSVSSDSGNSTASTKTDKTDE
PVPGASSAPAALSPQEKRELDRLLSGFGFEREKQGAMYHTQHLRSRPAGGPAVPSSGRHV
VPAQVHVNGGALASERETDILDDELPNQDGHSAGSVGTLSSLDGVTNTSEGGYPEALSPL
TNGLDKPYPMEPMVNGGGYPYESASRAGPAHAGHTVPMRPSYSAQEGLAGYQREGPHPAW
PQPVTTSHYAHDPSSMFRSQSFSEAEPQLPPAPVRGGSSREAVQRGLNSWQQQQQQQQQP
QPQPQPRPPPRQQERVHLESLVASRPSPQPLAETPIPSLPEFPRAASQQEIEQSIEALNM
LMLDLEPASTAAPLHKSQSVPGAWPGASPLSSQPLSGSSRQSHPLTQSRSGYITSGHSLG
TPEPAPRASLESVPPGRSYSPYDYQPCSAGPNQDFRSKSPASSSLPAFLPTTHSPLGPQQ
PPASLPGLTAQPLLSPKEVTSDPSRTPEEEPLNLEGLVAHRVAGVQAREKQPAEPPAPLR
RRAASDGQYENQSPEATSPRSPGVRSPVQCVSPELALTIALNPGGRPKEPHLHSYKEAFE
EMEGTSPSSPPPSGVRSPPGLAKTPLSALGLKPHNPADILLHPTGVTRRCIQPEEDEGKV
VVRLSEEPRSYVESVARTAVAGPRAQDSEPKSFSAPAAQAYGHEIPLRNGTLGGSFVSPP
LSTSSPILKSTLTSVGSFPSGESSDQGPRTPTQPLLESGFRSSSLGQPSPSAQRNYQSSS
PLPTVGSSYSSPDYSLQQFSSSPESQARAQFSVAGVHTVPGSPQARHRTVGTNTPPSPGF
GRRAINPSMAAPSSPSLSHRQVMGPPGTGFHGSTVSSPQSSAATTPGSPSLGRHPTGAYQ
VSGLHNNVATTPGSPSLGRHPGTHQGNLASGLHGNAVPSPGSPSLGRHLGGSGSVVPGSP
CLDRHVAYGGYSTPEDRRPTVSRQSSASGYQAPSTPSFPVSPAYYPGLSSPATSPSPDSA
AFRQGSPTPALPEKRRMSVGDRAGSLPNYATINGKVSSPVASGMSSPSGGSTVSFSHTLP
DFSKYSMPDNSPETRAKVKFVQDTSKYWYKPEISREQAIALLKDQEPGAFIIRDSHSFRG
AYGLAMKVSSPPPTIMQQNKKGDMTHELVRHFLIETGPRGVKLKGCPNEPNFGSLSALVY
QHSIIPLALPCKLVIPNRDPTDESKDSSGPANSTADLLKQGAACNVLFINSVDMESLTGP
QAISKATSETLAADPTPAATIVHFKVSAQGITLTDNQRKILFCASPNQLAYLGCCLPPGV
PFALPSCPLPSPACRLFGFVARKQGSTTDNACHLFAELDPNQPASAIVNFVSKVMLNAGQ
KR
Download sequence
Identical sequences ENSMMUP00000018128 9544.ENSMMUP00000018128 ENSMMUP00000018128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]