SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018489 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018489
Domain Number 1 Region: 450-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.08e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-24
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 3 Region: 17-77
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-24
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 4 Region: 338-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-22
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 6 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.4e-22
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 7 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.66e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 283-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000188
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 226-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000883
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018489   Gene: ENSMMUG00000014066   Transcript: ENSMMUT00000019748
Sequence length 661
Comment pep:known chromosome:MMUL_1:X:45662124:45736542:1 gene:ENSMMUG00000014066 transcript:ENSMMUT00000019748 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPANEDAPQPGEHGSACEVSVSFEDVTVDFSREEWQQLDSTQRRLYQDVMLENYSHLLSV
GFEVPKPEVIFKLEQGEGPWTLEGEAPHQSCSDGKFGIKPSQKRISGKSTLHSEMEGEDT
RDDSLYSILEELWQDAEQIKRCQEKQNKLLSHTSFLNKKILNTEWDYEYKDIGKFVHPSP
NLILSQKRPHKRDSFGKSFKHNLDLHIHNKSNAAKNLDKTIGHGQVFTQSSSYNHHENTH
TGVKFCERNQCGKVLSLKRSLSQNVKFPIGEKANTCTEFEKIFTQRSDFFAPQKIHTVEK
PHELSKCVNVFTQKPLLSIYLRVHRDEKLYICTKCGKAFIQNSELIMHEKTHTREKPYKC
NECGKSFFQVSSLLRHQTTHTGEKLFECGECGKGFSLNSALNIHQKIHTGERHHKCSECG
KAFTQKSTLRMHQRIHTGERSYICTQCGQAFIQKAHLIAHQRIHTGEKPYECSDCGKSFP
SKSQLQMHKRIHTGEKPYICTECGKAFTNRSNLNTHQKSHTGEKSYICAECGKAFTDRSN
FNKHQTIHTGEKPYVCADCGRAFIQKSELITHQRIHTTEKPYKCPDCEKSFSKKPHLKVH
QRIHTGEKPYICAECGKAFTDRSNFNKHQTIHTGDKPYKCSDCGKGFTQKSVLSMHRNIH
T
Download sequence
Identical sequences F7AFT7 G7Q2L9
9544.ENSMMUP00000018489 XP_014982786.1.72884 ENSMMUP00000011661 ENSMMUP00000018489

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]