SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018671 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018671
Domain Number 1 Region: 314-371
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 202-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 2-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.14e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 4 Region: 147-203
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.4e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 258-315
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 360-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.21e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 111-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000578
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018671   Gene: ENSMMUG00000000361   Transcript: ENSMMUT00000019948
Sequence length 418
Comment pep:novel chromosome:MMUL_1:19:62360087:62364817:1 gene:ENSMMUG00000000361 transcript:ENSMMUT00000019948 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFQGSVTFQDVAIDFSKEEWGFLNPAQRDLYTTVMLENYQNLVWLGLSISKSVISLLEKR
KLPWIMGKQLKFNLFSSSDTPGAEIKELSAKRAINEVLSQFDTVIKCTRNICKECGNVYC
HNTQLTLRKRNHTRKKCNQCLDCGKHFTRRSTLIQYQRIHTGERPYKCNECSKTFNQRAH
LTQHERIHMGEKPYKCKEGRKTFSQMTHLTQHQSTHTREKFHECSECGKAFSRSSALMDH
QRIHSGEKPYECKECGRAFTQSAQLIRHQKTHSGEKPYECSKCKKSFVRLSSLIEHWRTH
TGEKPYQRKDCKKTFCRVMQLTLHRRVHTGEKPYECKQCGKAFSAHSSLVTHKRTHSGEK
PYKCKECGKAFSAHSSLVTHKRTHTGEKPYKCHACGKAFNTSSTLCQHNRIHTGEKPF
Download sequence
Identical sequences ENSMMUP00000018671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]