SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018758 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018758
Domain Number 1 Region: 395-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.09e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 227-283
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.23e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 562-619
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.55e-23
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 4 Region: 282-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.79e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 339-395
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-22
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 451-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.24e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 604-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.97e-21
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 8 Region: 506-563
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 3-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.97e-18
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 10 Region: 190-240
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018758   Gene: ENSMMUG00000014282   Transcript: ENSMMUT00000020042
Sequence length 662
Comment pep:known chromosome:MMUL_1:19:63257381:63266812:1 gene:ENSMMUG00000014282 transcript:ENSMMUT00000020042 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLTEDCMVFEDVAIHFSQEEWGILNGVQRHLHSDVMLENFALLSSVGCWHGAKDEEAPS
KQCVSVGVSQVTTLKPALCTQKAPPCETCSSLLKDILHLAEHDRTHPKRTAELYLHQKEH
VREKLTRSDEGRPSFVNDSVHLAKRNFTCMHGGKDFTGDSDLQQQAFPSGWKPHRDTRGV
EAFQSGQNDYSCSQCGKDFCHQRMLFEHQKIHTEERPYECSECGKFFRYNSDLIKHQRNH
TGERPYKCSECGKAFSLKYNVVQHQKIHTGERPYECSECGKAFLRKSHLLQHQRIHTRPR
PYLCSECGKTFLTQAHLVGHQKIHTGERPYGCNECGKYFMYSSALIRHQKVHTGERPFYC
CECGKFFMDSCTLIIHQRVHTGEKPYECNECGKFFRYRSTLIRHQKVHTGEKPYECSECG
KFFMDTSTLIIHQRVHTGEKPYECSECGKFFRYCFTLNRHQRVHSGERPYECSECGKFFV
DSCTLKSHQRVHTGERPFECSICGKSFRCRSTLDTHQRIHTGERPYECSECGKFFRHNSN
HIRHRRNHFGERSFECTECGRVFSQNSHLIRHQKVHTRERTYKCSKCGKFFMDSSTLISH
QRVHTGEKPYECSECGKVFRYNSSLIKHRRIHTGERPYQCSECGRVFNQNSHLIQHQKVH
TR
Download sequence
Identical sequences ENSMMUP00000018758 ENSMMUP00000018758 9544.ENSMMUP00000018758

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]