SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018763 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018763
Domain Number 1 Region: 352-408
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-24
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 2 Region: 240-296
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.31e-24
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 3 Region: 295-352
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.69e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 408-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.85e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 5 Region: 24-81
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-22
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 6 Region: 449-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.57e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 201-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.78e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018763   Gene: ENSMMUG00000014286   Transcript: ENSMMUT00000020047
Sequence length 510
Comment pep:known_by_projection chromosome:MMUL_1:19:63298284:63304389:1 gene:ENSMMUG00000014286 transcript:ENSMMUT00000020047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAALRDPTQVSAAARGPARKDQGYVTFEDVAVYFSQEEWRLLDEAQRLLCRNVMLENF
SLLASLGLASSKTHDITQLESWKEPFMPASEVVTSAIPRGCWHGAEAEEAPEQSASVGLC
SSNVQEHQKQHCGEKSLKRQEGRVPVLRSCKVQVSEKSLQSWEVGKDLPTSSVILKHRVT
HTGEKSHRSSKSREAFHAGKRHFKCSECGKVFGQNYLLVQHQRLHTGKKPYECSECGKLF
RDMSNLFIHQIVHTGERPYGCSDCGKSFSRNAHLIEHQRVHTGEKPFTCSECGKAFRHNS
TLVQHHKIHTGVRPYECSECGKLFSFNSSLMKHQRVHTGERPYKCSECGKFYSHKSNLIK
HWRVHTGERPYECSECGKFFSQSSSLMQHRKVHTGEKPFKCNECGRFFRENSTLVRHQRV
HTGAKPYECRECGKFFSQSSTLMQHRKVHIGEKPFKCDECGRSFRENSSLIKHQRVHTGA
RPYECRECGKLFRHNSSLFKHRRIHTGEMQ
Download sequence
Identical sequences ENSMMUP00000018763 9544.ENSMMUP00000018763 ENSMMUP00000018763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]