SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018795 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018795
Domain Number 1 Region: 43-134
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.83e-39
Family SCAN domain 0.0000391
Further Details:      
 
Domain Number 2 Region: 362-418
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.53e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 323-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-19
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 407-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 5 Region: 218-252
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000575
Family KRAB domain (Kruppel-associated box) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018795   Gene: ENSMMUG00000014313   Transcript: ENSMMUT00000020081
Sequence length 480
Comment pep:known chromosome:MMUL_1:20:4921814:4934157:-1 gene:ENSMMUG00000014313 transcript:ENSMMUT00000020081 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAVPDLQPLPALEQDLEQNEILIVKVEEDFCLEEEPSVESEDPSPETFRQLFRLFCYQE
VAGPREALSRLWELCCRWLRPELRTKEQILELLVLEQFLTVLPGEIQARVREQQPESGEE
AVVLVEGLQREPRKHRQRGSELLSDDEVPLRMGRQSLKRQAEAQPEDLSLEEEARCSSQQ
PPAQLSHRPQRDPLLWPERGPPAPRHQEIASASPFHSAWSQAPVNLEDVAVYLSGEEPGC
LDPAQRDVPLENEGLGIQLEDGGDGREDAPVRMEWYRVLSARCQGPGHPLPGQRPAPVRG
LVRPELPRGGPQPGRGASHGTDKPYTCPECGKGFSKTSHLTKHQRTHTGERPYKCLVCGK
GFSDRSNFSTHQRVHTGEKPYPCPECGKRFSQSSSLVIHRRTHSGERPYACTQCGKRFNN
SSHFSAHRRTHTGEKPYTCPACGRGFRRGTDLHKHQRTHTGAGSLLTLQPVAPGGPGAKA
Download sequence
Identical sequences A0A1D5R065
ENSMMUP00000018795 XP_001098209.1.72884 XP_014981039.1.72884 9544.ENSMMUP00000018795 ENSMMUP00000018795

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]