SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018827 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018827
Domain Number 1 Region: 487-562
Classification Level Classification E-value
Superfamily SH2 domain 0.00000000000138
Family SH2 domain 0.0026
Further Details:      
 
Domain Number 2 Region: 18-144
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000219
Family Pleckstrin-homology domain (PH domain) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018827   Gene: ENSMMUG00000014335   Transcript: ENSMMUT00000020115
Sequence length 568
Comment pep:known_by_projection chromosome:MMUL_1:1:1130304:1145699:-1 gene:ENSMMUG00000014335 transcript:ENSMMUT00000020115 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEEMHWPVPMKAIGAQNLLTMPGGVAKAGYLHKKGGTQLQLLKWPLRFVIIHKRCVYY
FKSSTSASPQGAFSLSGYNRVMRAAEETTSNNVPLDGGGVRWGPPWWHRAHRSPADLQSW
MALLRREIGHFHEKRDLPLDTSDSSSDTDSFYGAVERPVDISLSPYPTDNEDYEHDDEDD
SYMEPDSPEPGRLEDALTHPPAYPPPPVPTPRKPAFSDMPRAHSFTSKGPGPLLPPPPPK
HGLPDVGPAAEDSKREPLGPRRAEPCPRVPATPRRMSDPPLGTMPTTPGLRKPPCFRESA
SPSPEPWTPGHGACSTSSVAIMATATSRNCDKLKSFHLSPRGPPTSEPPPVPANKPKFLK
TAEEDPPREAAMPGLFVPPVAPRPPALKLPVPEATARPTVLPRPEKPQLPHLQRSPPDGQ
SFRSFSFEKPRQPSQADAGGDDSDEDYEKARLSSKPRVPLPNSVFINTTESCEVERLFKA
TSPRGEPQDGLYCIRNSSTKSGKVLVVWDEASNKVRNYRIFEKDSKFYLEGEVLFVSVGS
MVEHYHTHVLPSHQSLLLRHPYGYTRPR
Download sequence
Identical sequences 9544.ENSMMUP00000018827 ENSMMUP00000018827 ENSMMUP00000018827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]