SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018857 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018857
Domain Number 1 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-25
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 2 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.17e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.34e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.39e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 5 Region: 304-366
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.89e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 6 Region: 90-153
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.42e-22
Family KRAB domain (Kruppel-associated box) 0.0014
Further Details:      
 
Domain Number 7 Region: 249-305
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.01e-21
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 8 Region: 603-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-16
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 354-388
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000917
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018857   Gene: ENSMMUG00000003688   Transcript: ENSMMUT00000020146
Sequence length 650
Comment pep:known_by_projection chromosome:MMUL_1:19:22394891:22429131:-1 gene:ENSMMUG00000003688 transcript:ENSMMUT00000020146 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRQGGFRDVAGPLSLAAAGALGPLFTALYPVLQEAQPMWPCDLQVLEIHSEDARNPWKPR
NGQPEVLSVASQTSNWISGLIMHHMVFCFFKQGLLTFRDVAIEFSLEEWQRLDAAQQNLY
RNVMLENYRNLAFLGKTGIAVSKPDLITCLEQGKEPWNMKRHEMVDKAPAAICPHFAQDF
WPEQGMEDSFQKVLLRKYEKCGHENLQLRKSCKSVDECKVHREGYSKLNQCFTTTRSKVF
QCGKYLKVFHKFLNSNRHMIIHTGEKPYKCEECGKAFIWSSSLTKHKRIHTREKLFKCKE
CDKAFIWSSTLTRHKRIHTGEKPYKCEECGKAFNHSSTLTKHKTIHTGEKPYKEKPYKCE
ECGKAFSQPSHLTTHKRMHTGEKPYKCEECGKAFSQSSTLTTHKIIHTGEKPYKCEECGK
AFRKSSTLTEHKIIHTGEKPYKCEECGKAFSQSSTLTRHKRMHTGEKPYKCEECGKAFNR
SSKLTTHKIIHTGEKPYKCEECGKAFISSSTLTGHKRIHTREKPYKCEECGKAFSQSSTL
TRHKRMHTGEKPYKCEECGKAFKESSALTKHKIIHTGEKPYKCEKCGKAFNQSSILTNHK
KIHTREKPYTCKECGKSFNRSSTFTKHKVIHTGVKLYKCEECGKSFFWSS
Download sequence
Identical sequences ENSMMUP00000018857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]