SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018907 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018907
Domain Number 1 Region: 446-555
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.53e-30
Family PDI-like 0.01
Further Details:      
 
Domain Number 2 Region: 121-233
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.83e-28
Family PDI-like 0.014
Further Details:      
 
Domain Number 3 Region: 669-779
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.57e-28
Family PDI-like 0.036
Further Details:      
 
Domain Number 4 Region: 33-125
Classification Level Classification E-value
Superfamily Chaperone J-domain 4.06e-26
Family Chaperone J-domain 0.00022
Further Details:      
 
Domain Number 5 Region: 553-653
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.16e-25
Family PDI-like 0.024
Further Details:      
 
Domain Number 6 Region: 349-462
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000079
Family PDI-like 0.042
Further Details:      
 
Domain Number 7 Region: 234-345
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000272
Family PDI-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018907   Gene: ENSMMUG00000014394   Transcript: ENSMMUT00000020198
Sequence length 793
Comment pep:known chromosome:MMUL_1:12:46340184:46393381:1 gene:ENSMMUG00000014394 transcript:ENSMMUT00000020198 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVWLNKDDYIRDLKRIILCFLIVYMAILVGTDQDFYSLLGVSKTASSREIRQAFKKLAL
KLHPDKNPNNPNAHGDFLKINRAYEVLKDEDLRKKYDKYGEKGLEDNQGGQYESWNYYRY
DFGIYDDDPEIITLERREFDAAVNSGELWFVNFYSPGCSHCHDLAPTWRDFAKEVDGLLR
IGAVNCGDDRMLCRMKGVNSYPSLFIFRSGMAPVKYHGDRSKESLVSFAMQHVRSTVTEL
WTGNFVNSIQTAFAAGIGWLITFCSKGGDCLTSQTRLRLSGMLDGLVNVGWMDCATQDNL
CKSLDITTSTTAYFPPGATLNNREKNSILFLNSLDAKEIYLEVIHNLPDFELLSANTLED
RLAHHRWLLFFHFGKNENSNDHELKKLKTLLKNDHIQVGRFDCSSAPDICSNLYVFQPSL
AVFKGQGTKEYEIHHGKKILYDILAFAKESVNSHVTTLGPQNFPANDKEPWLVDFFAPWC
PPCRALLPELRRASNLLYGQLKFGTLDCTVHEGLCNMYNIQAYPTTVVFNQSNIHEYEGH
HSAEQILEFIEDLMNPSVVSLTPTTFNELVTQRKHNEVWMVDFYSPWCHPCQVLMPEWKR
MARTLTGLINVGSIDCQQYHSFCAQENVQRYPEIRFFPPKSNKAYQYHSYNGWNRDAYSL
RIWGLGFLPQVSTDLTPQTFSEKVLQGKNHWVIDFYAPWCGPCQNFAPEFELLARMIKGK
VKAGKVDCQAYAQTCQKAGIRAYPTVKFYFYERAKRNFQEEQINTRDAKAIAALINEKLE
TLQNQGKRNKDEL
Download sequence
Identical sequences A0A1D5QXP3 A0A2K6DWE4
9544.ENSMMUP00000018907 ENSMMUP00000018907 NP_001253905.1.72884 XP_011770470.1.29376 XP_011770471.1.29376 XP_014965977.1.72884 ENSMMUP00000018907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]