SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018926 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018926
Domain Number 1 Region: 33-173
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000779
Family Thioltransferase 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018926   Gene: ENSMMUG00000014407   Transcript: ENSMMUT00000020218
Sequence length 335
Comment pep:known_by_projection chromosome:MMUL_1:X:76509778:76568291:-1 gene:ENSMMUG00000014407 transcript:ENSMMUT00000020218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARWWVWCVSLTMAVALLIVYDVPSASAQRKKEMVLSEKVSQLMEWTNKRPVIRMNGDK
FRRLVKAPPRNYSVIVMFTALQLHRQCVVCKYELQLHFKIKNSYNVTGSFASRLYYFPDN
VYFHGLLFIQLNMNSAPTFINFPAKGKPKRGDTYELQVRGFSAEQIARWIADRTDVNIRV
IRPPNYAGPLMLGLLLAVIGGLVYLRRSNMEFLFNKTGWAFAALCFVLAMTSGQMWNHIR
GPPYAHKNPHTGHVNYIHGSSQAQFVAETHIVLLFNGGVTLGMVLLCEAATSDMDIGKRK
IMCVAGIGLVVLFFSWMLSIFRSKYHGYPYSFLMS
Download sequence
Identical sequences ENSMMUP00000018926 ENSMMUP00000018926 9544.ENSMMUP00000018926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]