SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000018977 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000018977
Domain Number 1 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.32e-24
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 2 Region: 475-531
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-23
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 418-475
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-22
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 4 Region: 307-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 363-419
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 6 Region: 251-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.48e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 7 Region: 531-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.22e-17
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 8 Region: 215-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.8e-16
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 
Domain Number 9 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-16
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000018977   Gene: ENSMMUG00000014453   Transcript: ENSMMUT00000020276
Sequence length 654
Comment pep:known_by_projection chromosome:MMUL_1:10:51629394:51640885:1 gene:ENSMMUG00000014453 transcript:ENSMMUT00000020276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFRDVAVDFTQDEWRLLSPAQRTLYREVMLENYSNLVSLGISFSKPELITQLEQGKETW
REEKNCSPATCPADPEPELYLDPFCPPGFSSQKFPMQHVLCNHPPWIFTCLCTEGDVQPG
DPGPGDEQKQPQASEGRPWSDEAEGPGGEGARPLFGRTKKRTLGAFSRPPQRQPVTSRNS
LRGVELEASPAPTGNPEETDKLLKRIEVLGFGTVNCGECGLSFSKMTNLLSHQRIHSGEK
PYVCGVCEKGFSLKKSLARHQKAHSGEKPIVCSECGRGFNRKSTLIIHERTHSGEKPYMC
SECGRGFSQKSNLIIHQRTHSGEKPYVCRECGKGFSQKSAVVRHQRTHLEEKTIVCSDCG
LGFSDRSNLISHQRTHSGEKPYTCKECGRCFRQRTTLVNHQRTHSKEKPYVCGVCGHSFS
QNSTLISHRRTHTGEKPYVCGVCGRGFSLKSHLNRHQNIHSGEKPIVCKDCGRGFSQQSN
LIRHQRTHSGEKPMVCGECGRGFSQKSNLVAHQRTHSGERPYVCRECGRGFSHQAGLIRH
KRKHSREKPYMCRQCGLGFGNKSALITHKRAHLEEKPCVCRECGQGFLQKSHLTLHQMAH
KGEKPYVCKMCGQGFSLKSHLSRHRKTKSVHHRLPPHPDPEPCAGQPSDSLYSL
Download sequence
Identical sequences 9544.ENSMMUP00000018977 XP_015005037.1.72884 XP_015005038.1.72884 ENSMMUP00000018977 ENSMMUP00000005777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]