SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019043 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019043
Domain Number 1 Region: 7-172
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.53e-35
Family Phosducin 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019043   Gene: ENSMMUG00000014503   Transcript: ENSMMUT00000020346
Sequence length 235
Comment pep:novel chromosome:MMUL_1:1:55009308:55010065:1 gene:ENSMMUG00000014503 transcript:ENSMMUT00000020346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQDRNADTEWNDILHKKGILPPKESLKELEEEEGMTLEELEDHEDEFYAEDVRTIEMYRR
QRLAEWNATKLNNKFGEVLEISGKDSVQEVIKAGEGLWVILHLYKQGIPLCALINQHLSG
IARKFPDVKFIKAISTTCIPSYPDRNLPMIFVYLVGDIKAQFIGPLVFGSMNLKLFSENS
SKLSESGAIKTDLEENTKKPIKDVLLSSVQCSVPVKRDSDSEGHWGCSCYHMSNF
Download sequence
Identical sequences ENSMMUP00000019043 ENSMMUP00000019043 9544.ENSMMUP00000019043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]