SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019117 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019117
Domain Number 1 Region: 52-304
Classification Level Classification E-value
Superfamily alpha/beta-Hydrolases 9.25e-51
Family Epoxide hydrolase 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019117   Gene: ENSMMUG00000014557   Transcript: ENSMMUT00000020424
Sequence length 305
Comment pep:known_by_projection chromosome:MMUL_1:3:51270625:51273287:-1 gene:ENSMMUG00000014557 transcript:ENSMMUT00000020424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRCTRAWRLPLEGLGPHSPSFARVPVAPSSSGGRGEAEPRPLPLSYSLLDGEAALPAVI
FLHGLFGCKTNFNSIAKAFAQQTGRRVLTVDARNHGNSPHSPDMSYEIMSQDLQDLLPQL
DLVPCVVVGHSMGGRTAMLLALQRPELVERLIAVDISPVEGTGSSHFPAYVAAMRTVNIP
DGLPRSHARKLADEQLSSVVQNLAVRQYLLTNLVEVDGRLAWRLNLDALAQHLDKLLTFP
QRQESYLGPTLFLLGGNSQFVHPSHHPEIIRLFPRAQIQTVPNAGHWIHAERPQDFIDAI
RGFLV
Download sequence
Identical sequences ENSMMUP00000019117 9544.ENSMMUP00000019117 ENSMMUP00000019117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]