SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019451 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019451
Domain Number 1 Region: 21-49,97-182
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.09e-25
Family Voltage-gated potassium channels 0.0046
Further Details:      
 
Domain Number 2 Region: 277-361
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.49e-21
Family Voltage-gated potassium channels 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019451   Gene: ENSMMUG00000014815   Transcript: ENSMMUT00000020787
Sequence length 383
Comment pep:known_by_projection chromosome:MMUL_1:9:116820196:116833144:1 gene:ENSMMUG00000014815 transcript:ENSMMUT00000020787 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASGHPQARRCCPEALGKLFPGFCFLCFLVTYALVGAVLFSAIEDGQVLVAADDGEFEK
FLEELCRILNCSETVVEDRKQDLQGHLQKVKPQWFNRTTNWSFLSSLFFCCTVFSTVGYG
YIYPVTRLGKYLCMLYALFGIPLMFLVLTDTGDILATILSTSYNRFRKFPFFTRPLSKWC
PKSLFKKKPEPKPADEAVPQIIIGAEELPGPKLGKCPSRPSCSMELFERSHAREKQNTLQ
LPPQAMERSNSCPELVLGRLSYSIISNLDEVGQQVERLDIPLPIIALIVFAYISCAAAIL
PFWETQLDFENAFYFCFVTLTTIGFGDTVLEHPNFFLFFSIYIIIGMEIVFIAFKLVQNR
LIDIYKNVMLFFAKGKFYHLVKK
Download sequence
Identical sequences 9544.ENSMMUP00000019451 ENSMMUP00000019451 ENSMMUP00000019451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]