SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000019665 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000019665
Domain Number 1 Region: 283-562
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.99e-45
Family Protein kinases, catalytic subunit 0.00046
Further Details:      
 
Domain Number 2 Region: 18-81
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000593
Family LIM domain 0.00045
Further Details:      
 
Domain Number 3 Region: 128-222
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000197
Family PDZ domain 0.021
Further Details:      
 
Domain Number 4 Region: 75-107
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000228
Family LIM domain 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000019665   Gene: ENSMMUG00000015001   Transcript: ENSMMUT00000021031
Sequence length 617
Comment pep:known_by_projection chromosome:MMUL_1:10:75131466:75161869:1 gene:ENSMMUG00000015001 transcript:ENSMMUT00000021031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSYLSVPAYFTSRDPFRCSECQDSLTNWYYEKDGKLYCPKDYWGKFGEFCHGCSLLMTG
PFMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLYCGKCHNEVVLAPMFERLSTES
VQDQLPYSVTLISMPATTEGRRGFSVSVESACSNYATTVQVKEVNRMHISPNNRNAIHPG
DRILEINGTPVRTLRVEEVEDAISQTSQTLQLLIEHDPVSQRLDQLRLEAQLAPHMQNAG
HPHTLSTLDTKENLEGTLRRRSLRRSNSISRSPGPSSPKEPLLFSRDISRSESLRCSSSY
SQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMKELIRCDEETQKTFLTEVKVMR
SLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNMDPFPWQQKVRFAKGIASGMAY
LHSMCIIHRDLNSHNCLIKLVCPTALGLASRVLSFLASLSQRRLTWLSKAGHLGLRKDYF
QVMSVQDSFVLSCVPQGKSYDETVDIFSFGIVLCEQIHEVAVTLCPFLTEALLDEGVYLR
SYNQEVAEPRFLPPTPWPCSYSTCNLPPSRPAFSKLEDSFEALSLYLGELGIPLPAELEE
LDHTVSMQYGLTRDSPP
Download sequence
Identical sequences ENSMMUP00000019665

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]