SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020054 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020054
Domain Number 1 Region: 37-190
Classification Level Classification E-value
Superfamily C-type lectin-like 4.12e-31
Family C-type lectin domain 0.0000708
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020054   Gene: ENSMMUG00000015293   Transcript: ENSMMUT00000021441
Sequence length 191
Comment pep:known_by_projection chromosome:MMUL_1:11:9889532:9914919:1 gene:ENSMMUG00000015293 transcript:ENSMMUT00000021441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHDSNNVEKDIAPSELPANPGYRHSKQHSGKATLIWPLFFLIMFLTIIVCGMVVALSAIR
ANCHQKPSVCLQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDAALAQVESFQELN
FLLRYKGPSDHWIGLSREQGQPWKWINGTEWTRQFPILGAGEYAYLNDKGASSARYYTER
KWICSKPDTYV
Download sequence
Identical sequences ENSMMUP00000020054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]