SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000020110 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000020110
Domain Number 1 Region: 103-238
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.14e-34
Family Glutathione S-transferase (GST), C-terminal domain 0.000000152
Further Details:      
 
Domain Number 2 Region: 11-102
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.32e-26
Family Glutathione S-transferase (GST), N-terminal domain 0.00000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000020110   Gene: ENSMMUG00000015334   Transcript: ENSMMUT00000021501
Sequence length 241
Comment pep:known chromosome:MMUL_1:9:103959611:103972286:1 gene:ENSMMUG00000015334 transcript:ENSMMUT00000021501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRESARSLGKGSAPPGPVPEGSIRVYSMRFCPFAERTLLVLKAKGIRHEVININLKNKP
EWFFKKNPFGLVPVLENSQGQLIYESPITCEYLDEAYPGKKLLPDDPYEKACQKMILELF
SKVPSLVGSFIRSQNKEDYAGLKEEFRKEFTKLEEVLTNKKTTFFGGNSISMIDYLIWPW
FERLEAMKLYECVDHTPKLKLWMAAMKEDPTVSALLISGKDWQGFLELYLQNSPEACDYG
L
Download sequence
Identical sequences A0A2K6ABF9 C0SJM5 F6SPY0
ENSMMUP00000020110 ENSMMUP00000020110 9544.ENSMMUP00000020110 ENSPANP00000020962 NP_001247484.1.72884 NP_001274622.1.63531 XP_011832904.1.47321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]